Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MRSLQEEVRECVQVLETRTTEIFSELAQACSLERTGETVNLRPWVHEKNLTLTQAELLRLVDAAVQHQENQMRLTPLIERIKERDTKQRQTIMRVSELQTELLALLERGERNAKDMKKAESTPIYYNDILEYAQRLARYTSAPRGHRLQEASQVNEATGDTSIAAAQSQKVSQTNSKASEQHQQHHIEFGKSDYNQNATRAMSYYDPVIPETPQELPFPSDRLMRQGILYADAAKEDGVMTEPTDATAQSSTKEEHELVESQKPAVPAVPVLDSFAMDTDDAFDLDLNP |
Length | 289 |
Position | Middle |
Organism | Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Malasseziomycetes> Malasseziales> Malasseziaceae> Malassezia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.743 |
Instability index | 52.20 |
Isoelectric point | 4.94 |
Molecular weight | 32800.18 |
Publications | PubMed=18000048 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP24799 No repeats found |
MoRF Sequence | Start | Stop |
1) AMSYYDPVI 2) DRLMRQGILY 3) DTDDAFDLDL 4) PIYYNDILEYA | 201 221 278 123 | 209 230 287 133 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab