Description | Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MSTAAESPRPTEPEGNGDWKNLKLSLERPYKDDSGERIPNVLDIQPDGTYIYEPIESADERLKSNLHRIFQERGFDFFEKPEKRTTDGTSAQESSTADGEEAEEPEKEEKHKPMTFEDLNAMRSELLPQLYVALGEMTQARDILESVLSTTQKPPLSTDAPTAGLSATVVSKLPSLPSLQAFNAQIVIGSKDEALRKAAGLFNTVAERMQRTHEQSEQYWINALKIRGNNWRMVPSPLPAGTFLGKNSDRTARDFLVLYGLEESPPAIRRRGIAYLSDVSDGSQLMFTRRQHMRIKVTLIHRNDDGTEHWTVNRHSVNLESEDLNESLREAQLELVDEEIFSSLIKEASSLPTALARVSERLIVIDASQGVELRFELTKDQASSEDRVSPLCALIYHLLHILLLRRHAYIKAERLNSSGNFPTPNPIGYQPYMLQPIIDFLQYKVFCQRLEKELRYASRGLNAVGVPAEVVFDAVGETGEEIVQIFTESRHRHASGEAILRIENKQTLRLTFVAPSNLNAHLAQATLQVYSLPQLSQLLKTEIERFILQQICQLGEKLRGGTWFIDLNHLVARWEAFVYTFHITFDADMKINCAAFCLDNKSGKRASHHYAETHGSILTWVQNLIEQNS |
Length | 629 |
Position | Head |
Organism | Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Psathyrellaceae> Coprinopsis. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.439 |
Instability index | 52.08 |
Isoelectric point | 5.56 |
Molecular weight | 71181.56 |
Publications | PubMed=20547848 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP24796 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 145.19| 45| 402| 32| 81| 1 --------------------------------------------------------------------------- 32- 81 (72.21/67.72) DDSGE.RIPNVLDIQPdgtYIYEPI......ESADERLKSNLHriFQERGFDFFEKP 416- 467 (72.98/52.27) NSSGNfPTPNPIGYQP...YMLQPIidflqyKVFCQRLEKELR..YASRGLNAVGVP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EGNGDWKNLKLSLERPYKDDSGERIPNVLDIQPD 2) TYIYEPIES | 14 49 | 47 57 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab