<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24792
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSSILLAPLNELQALSHTLFLSLSPPQTRPPPAPPLSAFLECDKALAAAVNLAHVHQVRQRKIESLEQELLELERRWRDICMELANGKKELEEIIEEGDERIKAIRAAKEAAIPYPELLTYAQSLSQFSSAPPNMPDLSLPGQPPPPKFFPPFPNEEKMRRGRLNAEEPLPLLGETHSVGKVPTVSPEDALDRHTSAANPYRHEFRGVDQPYFDLDLDLNPDLDD |
Length | 225 |
Position | Middle |
Organism | Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Psathyrellaceae> Coprinopsis.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.502 |
Instability index | 69.46 |
Isoelectric point | 4.93 |
Molecular weight | 25204.33 |
Publications | PubMed=20547848
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24792
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.93| 18| 114| 21| 44| 1
---------------------------------------------------------------------------
22- 44 (25.26/19.49) SLsPPQTrPPPA..PPlsaFLECDK
139- 158 (34.67/ 9.66) SL.PGQP.PPPKffPP...FPNEEK
---------------------------------------------------------------------------
|