<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24790
| Description |
Uncharacterized protein |
| Sequence | MSDPSPSQVQILQERIAALSDLYSQLQSIRHIPASFLKRPAALAPTRSVRDEFQRVKEVAALVRSEAVQTALVEAEQSKRADPSNIDPNYRREHRKRRRPPSPESPQPYVPVEKTPTTFFPPEDLQGPLVAFDGLVPFVREYNKADKPCRLHIWERTREQRQERPRMLRFTIPDVLTAYISLGSPAATNNTVIVQTVTAFGPRERKAPHTQSDYTVYRLLSQEIAKMIRSEEQVPLKAILNLLEAYTGLFAEGCTVCNCVMTAEGHVPPVVRLCKAGRREAKHVTCINA |
| Length | 289 |
| Position | Tail |
| Organism | Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Psathyrellaceae> Coprinopsis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.464 |
| Instability index | 72.69 |
| Isoelectric point | 9.36 |
| Molecular weight | 32660.08 |
| Publications | PubMed=20547848
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24790
No repeats found
No repeats found
|