<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24778
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQADPPPPPAALGFGPGKPPPPPPPPPGGGPGPAPPPTAASAPPGSDKSAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKQKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGMGSSQASSSSSLR |
| Length | 244 |
| Position | Head |
| Organism | Bos taurus (Bovine) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae>
Bovinae> Bos.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.021 |
| Instability index | 67.17 |
| Isoelectric point | 9.83 |
| Molecular weight | 26248.76 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP24778
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.97| 16| 17| 190| 205| 2
---------------------------------------------------------------------------
170- 183 (25.17/10.97) P..PKKKNKQKHKQSR
190- 205 (27.71/12.77) PETPSDSDHKKKKKKK
209- 224 (27.09/12.33) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.84| 19| 114| 110| 130| 4
---------------------------------------------------------------------------
53- 76 (28.99/10.29) PGS.DKSAagcgpFYLM....RELPGSTE
119- 142 (24.85/16.27) PGShDNSS.....LRSLiekpPILGGSFN
---------------------------------------------------------------------------
|