Description | Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MSNQALYEKLGQTTELISSKLTELIKLASIESSSDHNEENDSGYNDNILDESELSVATSSVLMVNNQTAQLIKGVQDLLILTRHIREKWLLNHIPEQTHSGPQIDNEELKSLLNTCMKDIIGDVDI |
Length | 126 |
Position | Head |
Organism | Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Vanderwaltozyma. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.387 |
Instability index | 54.53 |
Isoelectric point | 4.50 |
Molecular weight | 14090.62 |
Publications | PubMed=17494770 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR007936 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP24773 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 121.75| 40| 54| 12| 54| 1 --------------------------------------------------------------------------- 12- 54 (59.77/41.06) QTTELISSKLTELIKLASIESSS..DH.NEENDSGYNdniLDESEL 67- 109 (61.99/35.41) QTAQLIKGVQDLLILTRHIREKWllNHiPEQTHSGPQ...IDNEEL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GYNDNIL 2) KLASIE | 43 26 | 49 31 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab