<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24760

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMNELENCTYNLENVLLSFYKIANVQKINYNQYNSKKNDEQWAIHTELLLRKKNPSSLVASLSKELWCFSLNDDQIPDIPKNNNSNEIIHPDKSGNFNSNYSKPNLPPHYAIFLKALRRMIYINLTKSSINKLYPFGNGSIFMDSKNSTCIFQVEPHLFENGDLTISLSLKNLNIVQLNLNNLDDSFLKNNAIYLLPLGTRAYLPSSNISACIAQPPENSDALLNTLLISHGIDLISKKNLQWVKLIPHLGHFNGHIPRISSYIDTPKDSRSVIWPIDLIFVQPALQVDKKKPSSPKRDIDDLNFNLDDALDIVDNFIQLRQSSAYRTPGSSGILTGTNPLSSGGAYTDQFQNFQRNMAISSNGSTQSYKQKITPSDSNINYTMEKRNANSVEQFGMSELITSDLDHLNDKRNYNPDLLGSPLKSESNRRILNFDNQIRSTERTPNLSKESSQLENESNNSAADKELFGEEEEEQEVVAGAEEEEDGEEVEEEEEEEEEDLFGESNNSSEEKSRNKRESSDEITEDMFGLSDDEDATKSNTNLSDQNFFRHSENENIINVAKPNNKRKYLDIPLDEITLSNTPLYTDPGAPLPVETPRDRRKSVFAPLNFNPIIEHTVDNKYKNGGKFSFSPSHNEEALNFDISKNGLSTSEDDDSDFSDDLEGLEVKPIERGTDNNGTDSQFLEQNSLQVLSEPLPPSLLRGELLSGNDNNNIDVMKENLNSIWKINQNGMNTNDSPIRAIEASYGPMDVDSKSSSDIFPKMPITRDQPLSANRSPDLAHVDIIETNFEPKGTELQPANFEFSSNPLSSLPFLLRHMPLSTIPEVFLSSTPSLTISDDNQRVLNLLSEQLVYDFDTLQGLNIPSRSYKGITSCTNGLITNVISNLFPNFDRINGSDIISQFYPMREPYVYVKKHHDIIKIRADSQPFSKYLNLKPSKGIKNFRFLLITTSSKENCSTFVSTLCQTYIGYEFGFCELLKLNNEDTQGMIYLQDYEDNKLLLLAAQIVSYCSTNKSSGKEVPLLLVLPLKTNRLSDLVEMTSKFEIINNEVKSKIPNAQIFFKAILMDFINNPLVSIDEYFNQCVSIYNILPQKSIKFASIAPKHPEKIKFRTLQSSGGPSVIHYDSYIHLAYSRSLDKQWVFAAFSDSNGNDNLTRAWYVGSSKNKFDETCNEIWYIALKLASKKYGKICLILTRLNSVLPDDELMNWRRLSGRNVHLAVVCVDDTEKISFYDQDENYPSFKKFFKNENYTNALQKEDLEEYEIRDIDYEVHGIIFKSPFPLSNSQHRCAIKSGALMKFHEAAGEALWDKFEVNLLNCPHSDSTQLLKTILEEYRNLAALSTWFGVSNGDSAQIPWHVLAVKKMMKCLVHLQVSNK
Length1375
PositionKinase
OrganismVanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Vanderwaltozyma.
Aromaticity0.09
Grand average of hydropathy-0.539
Instability index43.33
Isoelectric point5.05
Molecular weight155963.95
Publications
PubMed=17494770

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblFungi

GO - Biological Function
transcription coactivator activity	GO:0003713	IEA:EnsemblFungi

GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter by galactose	GO:0000435	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP24760
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.34|      20|      20|     469|     488|       1
---------------------------------------------------------------------------
  469-  488 (31.84/18.04)	EEEEEQEV...VAGAEE...EEDGEE
  492-  514 (28.19/15.15)	EEEEEEED...LFGESNnssEEKSRN
  515-  534 (17.32/ 6.55)	KRESSDEItedMFGLSD...DED...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.24|      13|      17|    1157|    1170|       2
---------------------------------------------------------------------------
 1157- 1170 (22.77/16.84)	WYVG...SSKnKFDETC
 1174- 1189 (21.47/10.68)	WYIAlklASK.KYGKIC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     231.27|      57|     154|     685|     771|       3
---------------------------------------------------------------------------
   94-  155 (86.42/34.10)	GNFN.SNYS..KPNLPPHYAIFLKALrrmiyiNLTKSSINKLYPfGNGSIFMDSKNSTCIFQVEP
  552-  586 (42.90/10.58)	ENENiIN..VAKPNNKRKY...............LDIPLDEITL.SNTPLYTD............
  707-  763 (101.95/75.95)	GNDN.NNIDVMKENLNSIWKINQNGM......NTNDSPIRAIEA.SYGPMDVDSKSSSDIFPKMP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.93|      11|      15|     875|     887|       4
---------------------------------------------------------------------------
  875-  887 (16.13/14.67)	NGliTNVISNLFP
  893-  903 (21.80/12.53)	NG..SDIISQFYP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.50|      17|      33|     314|     346|       6
---------------------------------------------------------------------------
  314-  330 (30.06/37.34)	DNFIQLRQSSAYRTPGS
  348-  364 (30.45/ 7.39)	DQFQNFQRNMAISSNGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.61|      20|     153|     629|     648|       7
---------------------------------------------------------------------------
  629-  648 (36.75/18.61)	FSPSHNE.EALNFDISKNGLS
  788-  808 (33.85/16.58)	FEPKGTElQPANFEFSSNPLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     148.66|      44|     153|     925|     970|       8
---------------------------------------------------------------------------
  925-  970 (69.90/53.62)	QPFSKYlNLKPSKGIKnFRFLLITTSSKENCSTFVSTLCQTYIGYE
 1081- 1124 (78.76/51.08)	QCVSIY.NILPQKSIK.FASIAPKHPEKIKFRTLQSSGGPSVIHYD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      67.53|      15|      15|     402|     416|      10
---------------------------------------------------------------------------
  377-  398 (17.29/ 8.36)	SNINYTMEKRNANsveqfgmSE
  402-  416 (26.83/18.25)	SDLDHLNDKRNYN.......PD
  420-  434 (23.40/14.69)	SPLKSESNRRILN.......FD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.63|      10|     256|     769|     778|      14
---------------------------------------------------------------------------
  769-  778 (19.21/11.97)	PLSANRSPDL
 1026- 1035 (18.41/11.11)	PLKTNRLSDL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24760 with Med13 domain of Kingdom Fungi
Unable to open file!