<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24754

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMSGQPPLDELQWKSPEWIQAFGLRTDNVLDYFAESPFFEKTSNNQVIKMQRQFSQMPVMDNPSGNTPANGGGDQQQQQQQQQQSQQSQQQQQSQQSQQQQQQQINIFKTSVNHQDQDQEFGYVDMIRRDILTRYPMHAMLERELGKMKGVEYVLSYVREPDFWIIKKQNRISSESTQPLQAYYIIGANVYQSPTVFKVVQSRLLSTSYHLSSTLKTLRNLIQFEPSQGVQFKTIQDESYSTPTSTSNNDIGTNGNSVSNTTLSASATVATTQPASTSQFDHNGFQTNQDKLTRDMMDTLMVMSIKSKPEYI
Length311
PositionHead
OrganismVanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Vanderwaltozyma.
Aromaticity0.09
Grand average of hydropathy-0.832
Instability index62.56
Isoelectric point5.62
Molecular weight35559.03
Publications
PubMed=17494770

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. 
ECO:0000256	PIRNR:PIRNR013286
GO - Cellular Component
core mediator complex	GO:0070847	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coactivator activity	GO:0003713	IEA:EnsemblFungi
GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly	GO:0051123	IEA:EnsemblFungi

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP24754
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.45|      14|      15|      73|      86|       1
---------------------------------------------------------------------------
   73-   86 (27.89/10.03)	DQQQQQQQQQQSQQ
   90-  103 (27.56/ 9.84)	QQQSQQSQQQQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      94.94|      28|      28|     227|     254|       2
---------------------------------------------------------------------------
  196-  224 (18.32/ 7.92)	.....FKVVQSRllstSYhlSS........TLKTLRNLIQFE
  226-  253 (50.27/35.18)	SQGVQFKTIQDE....SY..ST........PTSTSNNDIGTN
  254-  282 (26.34/14.76)	GNSVSNTTL...........SAsatvattqPASTSQFD..HN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.87|      13|      18|      32|      44|       3
---------------------------------------------------------------------------
   32-   44 (23.46/13.72)	FAESPFFEKTSNN
   53-   65 (25.41/15.39)	FSQMPVMDNPSGN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24754 with Med6 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KMQRQFSQMPVMDNPSGNTPANGGGDQQQQQQQQQQSQQSQQQQQSQQSQQQQQQQINIFKTS
2) TLSASATVATTQPASTSQFDHNGFQTNQDKLT
48
261
110
292










Molecular Recognition Features






MoRF SequenceStartStop




NANANA