<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24754
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MSGQPPLDELQWKSPEWIQAFGLRTDNVLDYFAESPFFEKTSNNQVIKMQRQFSQMPVMDNPSGNTPANGGGDQQQQQQQQQQSQQSQQQQQSQQSQQQQQQQINIFKTSVNHQDQDQEFGYVDMIRRDILTRYPMHAMLERELGKMKGVEYVLSYVREPDFWIIKKQNRISSESTQPLQAYYIIGANVYQSPTVFKVVQSRLLSTSYHLSSTLKTLRNLIQFEPSQGVQFKTIQDESYSTPTSTSNNDIGTNGNSVSNTTLSASATVATTQPASTSQFDHNGFQTNQDKLTRDMMDTLMVMSIKSKPEYI |
| Length | 311 |
| Position | Head |
| Organism | Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Vanderwaltozyma.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.832 |
| Instability index | 62.56 |
| Isoelectric point | 5.62 |
| Molecular weight | 35559.03 |
| Publications | PubMed=17494770
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP24754
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.45| 14| 15| 73| 86| 1
---------------------------------------------------------------------------
73- 86 (27.89/10.03) DQQQQQQQQQQSQQ
90- 103 (27.56/ 9.84) QQQSQQSQQQQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 94.94| 28| 28| 227| 254| 2
---------------------------------------------------------------------------
196- 224 (18.32/ 7.92) .....FKVVQSRllstSYhlSS........TLKTLRNLIQFE
226- 253 (50.27/35.18) SQGVQFKTIQDE....SY..ST........PTSTSNNDIGTN
254- 282 (26.34/14.76) GNSVSNTTL...........SAsatvattqPASTSQFD..HN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.87| 13| 18| 32| 44| 3
---------------------------------------------------------------------------
32- 44 (23.46/13.72) FAESPFFEKTSNN
53- 65 (25.41/15.39) FSQMPVMDNPSGN
---------------------------------------------------------------------------
|