<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24752
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MVLENECLRKIQETLAPVSKSQAQEQIQVKDELQPQGLSPPQSITRSSSMATTNTAITTNSSEFIPHIFYSMYQIKKDPNNSSNQLETSTGFIKHRLKSCKTLIESDEDCRKLLSKSTDEWDDYIKQRELEIEGKRNVLKSLNNKIGELLTE |
| Length | 152 |
| Position | Middle |
| Organism | Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Vanderwaltozyma.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.771 |
| Instability index | 60.68 |
| Isoelectric point | 5.80 |
| Molecular weight | 17350.38 |
| Publications | PubMed=17494770
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
cytosol GO:0005829 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | structural molecule activity GO:0005198 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP24752
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.25| 24| 29| 86| 114| 1
---------------------------------------------------------------------------
61- 84 (41.54/22.05) SSEFIPHIFYSMYQIKKDPNNSSN
89- 112 (41.71/38.36) STGFIKHRLKSCKTLIESDEDCRK
---------------------------------------------------------------------------
|