<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24747
| Description |
Predicted protein (Fragment) |
| Sequence | CIQHLNDLIWKYNVVTLDRLVLCLVTFDRLVLCLALRSHEGNEAQVCFFIIQLLLLKPQEFRNRVNAFVREGLLEVAGNAVLPVQYLPIYFGNVCLRFLPVFDIVIHRFLELPPVFKSLESLLDHLGSLYKFHDRPVTYLYNTLHYYDACLHEKASLKKKLVGAIIGAQRDIRPQGCEYGTPRVVDGRAGFRRWYNQINIPMLRFSHSNFGCWNHERKK |
| Length | 219 |
| Position | Tail |
| Organism | Nematostella vectensis (Starlet sea anemone) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria>
Edwardsiidae> Nematostella.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.054 |
| Instability index | 37.17 |
| Isoelectric point | 9.13 |
| Molecular weight | 25574.66 |
| Publications | PubMed=17615350
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
transcription regulator complex GO:0005667 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | positive regulation of gene expression GO:0010628 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP24747
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.35| 27| 52| 71| 97| 2
---------------------------------------------------------------------------
71- 97 (49.00/33.35) EGLLEVAGNAV....LPVQYL..PIYFGNVCLR
120- 152 (40.35/26.26) ESLLDHLGSLYkfhdRPVTYLynTLHYYDACLH
---------------------------------------------------------------------------
|