<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24745
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MADEEKQSEPFDLLEQTIEQFVETTRQIGIIVSDFQPGSQGVLNQKINMMVDNLREIEKCKAHVADVEVPLEVFEYIDQGRNPQLYTKDCLEKALVKNEQVKGKIDAYKNFKSLLVDELSKVLPKGMKEYNKIKESQGS |
| Length | 139 |
| Position | Middle |
| Organism | Nematostella vectensis (Starlet sea anemone) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria>
Edwardsiidae> Nematostella.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.589 |
| Instability index | 35.51 |
| Isoelectric point | 4.93 |
| Molecular weight | 15924.01 |
| Publications | PubMed=17615350
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP24745
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.08| 15| 27| 14| 28| 1
---------------------------------------------------------------------------
14- 28 (25.09/19.22) LEQTIEQFVETTRQI
43- 57 (25.98/20.12) LNQKINMMVDNLREI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.00| 21| 27| 77| 100| 2
---------------------------------------------------------------------------
77- 97 (37.24/30.78) IDQGRNPQLYTKDCLEKALVK
105- 125 (34.76/19.45) IDAYKNFKSLLVDELSKVLPK
---------------------------------------------------------------------------
|