Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MADEEKQSEPFDLLEQTIEQFVETTRQIGIIVSDFQPGSQGVLNQKINMMVDNLREIEKCKAHVADVEVPLEVFEYIDQGRNPQLYTKDCLEKALVKNEQVKGKIDAYKNFKSLLVDELSKVLPKGMKEYNKIKESQGS |
Length | 139 |
Position | Middle |
Organism | Nematostella vectensis (Starlet sea anemone) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria> Edwardsiidae> Nematostella. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.589 |
Instability index | 35.51 |
Isoelectric point | 4.93 |
Molecular weight | 15924.01 |
Publications | PubMed=17615350 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP24745 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.08| 15| 27| 14| 28| 1 --------------------------------------------------------------------------- 14- 28 (25.09/19.22) LEQTIEQFVETTRQI 43- 57 (25.98/20.12) LNQKINMMVDNLREI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.00| 21| 27| 77| 100| 2 --------------------------------------------------------------------------- 77- 97 (37.24/30.78) IDQGRNPQLYTKDCLEKALVK 105- 125 (34.76/19.45) IDAYKNFKSLLVDELSKVLPK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EPFDL 2) LEKALVKNE 3) LLVDELSKVLPKGMKEYNKIKES 4) RNPQLYTKD 5) VKGKIDAY | 9 91 114 81 101 | 13 99 136 89 108 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab