<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24744
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MRMQQEEKLIETSLEAITSRVQEVRDSVHTFLAKLEREPLNWPSVLDNFALLSVPDHLRTKYEPEVEEAEQSLVVASASITQENAQKQINHLNELLTTLTDMITSAKEDWEGEQNSVPDHLRTKYEPEVEEAEQSLVVASASITQENAQKQINHLNELLTTLTDIITSAKEDWEGEQNSASRSTSSTNPDIGALVAAVTFGKGLKPNKTTNSSKTRTSTSSEQGSAQWMNNKADQPGKHPSSIKTELKAAASPHPYAGRPPNRS |
Length | 264 |
Position | Head |
Organism | Nematostella vectensis (Starlet sea anemone) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria>
Edwardsiidae> Nematostella.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.751 |
Instability index | 45.68 |
Isoelectric point | 5.05 |
Molecular weight | 29199.90 |
Publications | PubMed=17615350
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IBA:GO_Central
transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP24744
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 248.78| 60| 60| 55| 114| 1
---------------------------------------------------------------------------
55- 114 (124.73/84.71) PDHLRTKYEPEVEEAEQSLVVASASITQENAQKQINHLNELLTTLTDMITSAKEDWEGEQ
118- 177 (124.05/84.21) PDHLRTKYEPEVEEAEQSLVVASASITQENAQKQINHLNELLTTLTDIITSAKEDWEGEQ
---------------------------------------------------------------------------
|