<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24739
Description |
Predicted protein |
Sequence | MSLEEEVCRIGKQLEKIVSQDSAMVPEEAVDLLTKLKDLPITLECLQKTRIGMSVNTMRKKSNNSNVQTLAKSLIKLWKKLLPEKSGSDKKADNGKASSEKSSRSTSPALSTKSDTSDAPTTPKDNKPISFPNTITDESVRGKCREMIVNSLQVQGEFEAVTKPEEVAAACEQLIFEEFKDTNVKYKQRIRSRVNNLRDPKNPMLKVRVLGGEISPARLAVMTSEEMASDEMKKLRQEFTKEGIREAQMAKNAGTKTNLFKCGRCGKRETTYNQLQTRSADEPMTTFVYCMNCGNRWKFC |
Length | 300 |
Position | Unknown |
Organism | Nematostella vectensis (Starlet sea anemone) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria>
Edwardsiidae> Nematostella.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.703 |
Instability index | 45.52 |
Isoelectric point | 9.23 |
Molecular weight | 33707.40 |
Publications | PubMed=17615350
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24739
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.72| 21| 120| 142| 162| 2
---------------------------------------------------------------------------
142- 162 (37.71/23.39) GKC..REMIVNSLQVQGEFEAVT
263- 285 (35.01/21.30) GRCgkRETTYNQLQTRSADEPMT
---------------------------------------------------------------------------
|