<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24731
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MATADKEAVNFPIETNFQESSEQCCTRFQVELEFVQCLANPHYLTFLAQRGYLKEQTFINYLKYLLYWKKPEYAKFLKYPQCLHFLELLQYEHFRRELVNPPCAKFIDEQQILHWQYYSRKRMRVAPPRSQTPSQSDAQLR |
Length | 141 |
Position | Middle |
Organism | Nematostella vectensis (Starlet sea anemone) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria>
Edwardsiidae> Nematostella.
|
Aromaticity | 0.16 |
Grand average of hydropathy | -0.608 |
Instability index | 52.72 |
Isoelectric point | 8.57 |
Molecular weight | 17097.43 |
Publications | PubMed=17615350
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP24731
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.50| 23| 24| 80| 102| 1
---------------------------------------------------------------------------
57- 72 (21.28/ 8.86) ....TFINYLKYLLYWKK...PE
80- 102 (44.31/24.61) PQCLHFLELLQYEHFRRELVNPP
110- 128 (35.91/18.87) QQILHW....QYYSRKRMRVAPP
---------------------------------------------------------------------------
|