<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24724
Description |
Predicted protein |
Sequence | MSQNNRRNRGPAPTGSTKASKIREMASALDYASHAIRSLNKELRKLGAENDVLETDVKDGNQALTENQKNVELILKKQDKSKKQAKLQELKLQRVFVRHLLNGLLEKVLAMSAPALAEREQKDLQSFCDRINKEKEAMTALLAEQTKKEEAKIAFFAELKRQLEQAKISSKKCTAESQTSSPSTTSMGTECTTECAEVDVQTTSEVTMVSAETQTDAVPEVIILNA |
Length | 226 |
Position | Middle |
Organism | Nematostella vectensis (Starlet sea anemone) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria>
Edwardsiidae> Nematostella.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.634 |
Instability index | 56.15 |
Isoelectric point | 8.26 |
Molecular weight | 25039.23 |
Publications | PubMed=17615350
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24724
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.18| 15| 16| 172| 186| 1
---------------------------------------------------------------------------
172- 186 (27.13/17.53) KCTAESQTSSPSTTS
190- 204 (26.05/16.58) ECTTECAEVDVQTTS
---------------------------------------------------------------------------
|