<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24723
| Description |
Predicted protein |
| Sequence | MADDLVSSLESSLQSCVSLLLSNEGIEKGQHHNDNTKGVEFTITKFLKNAQALEADFLNKQMYIRLNQPQETTKQEVGHLKTELAQKEELLNKLSERVDYWNKILDDLQRKQTEIEAADRKIPQVQTSAQKTL |
| Length | 133 |
| Position | Head |
| Organism | Nematostella vectensis (Starlet sea anemone) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria>
Edwardsiidae> Nematostella.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.732 |
| Instability index | 51.30 |
| Isoelectric point | 5.40 |
| Molecular weight | 15212.97 |
| Publications | PubMed=17615350
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24723
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.90| 14| 31| 47| 60| 1
---------------------------------------------------------------------------
47- 60 (22.86/15.90) LKNAQALEADFLNK
80- 93 (22.04/15.10) LKTELAQKEELLNK
---------------------------------------------------------------------------
|