<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24717
Description |
Predicted protein |
Sequence | MSPLTYTFIAGSSMDSWPSLQSSVMSALKEEEKHLPQPKPPAKPVENPITLTIQGQRTVQEIADKAIELFRKLQNARLSTDTTSRQSQAQTKDIRDQLNTLKGLLAKLRNVYNDTKRAVTIPAGENVENLIPLECSPRNEMDTSDGGGPVEQERAELQKKLKEKNDQLKEVIDKLRIAVWDINTMIMLKPS |
Length | 191 |
Position | Head |
Organism | Nematostella vectensis (Starlet sea anemone) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria>
Edwardsiidae> Nematostella.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.660 |
Instability index | 51.27 |
Isoelectric point | 7.77 |
Molecular weight | 21451.30 |
Publications | PubMed=17615350
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP24717
No repeats found
|