<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24717
| Description |
Predicted protein |
| Sequence | MSPLTYTFIAGSSMDSWPSLQSSVMSALKEEEKHLPQPKPPAKPVENPITLTIQGQRTVQEIADKAIELFRKLQNARLSTDTTSRQSQAQTKDIRDQLNTLKGLLAKLRNVYNDTKRAVTIPAGENVENLIPLECSPRNEMDTSDGGGPVEQERAELQKKLKEKNDQLKEVIDKLRIAVWDINTMIMLKPS |
| Length | 191 |
| Position | Head |
| Organism | Nematostella vectensis (Starlet sea anemone) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria>
Edwardsiidae> Nematostella.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.660 |
| Instability index | 51.27 |
| Isoelectric point | 7.77 |
| Molecular weight | 21451.30 |
| Publications | PubMed=17615350
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP24717
No repeats found
|