<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24716

Description Mediator of RNA polymerase II transcription subunit 6 (Fragment)
SequenceMAADASENQLGVSWHDSAWIPSLSPTNVLDYFSQRTNPFYDRTCNNEVVKMQRLDPATLLSMTGIEYSVIHVQDPILFVIRKQHRHSATQVTPMADYYILAGIVYQAPDMCSVVNSRMPLKKNIPSSCTGKETNNLFELSALHNFQSAFKEAVSYSRYHPSKGYWWQFKETQKNSKQKKEPAGNQETSSLFQREGVNLLLGELSRRFPPNFLKNPQTTTTQIKKEPETITEEATNEQTDATSRNSELAMNGTQPVVTQPRTQ
Length262
PositionHead
OrganismNematostella vectensis (Starlet sea anemone)
KingdomMetazoa
LineageEukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria> Edwardsiidae> Nematostella.
Aromaticity0.09
Grand average of hydropathy-0.671
Instability index41.27
Isoelectric point7.72
Molecular weight29755.07
Publications
PubMed=17615350

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364143
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
transcription coactivator activity	GO:0003713	IBA:GO_Central
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP24716
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.54|      28|      43|     145|     181|       1
---------------------------------------------------------------------------
  145-  181 (41.34/51.91)	FQsafKEAVSY......SRYHPskgywwQF.KETQKNSKQ.KKEP
  191-  226 (39.19/24.13)	FQ...REGVNLllgelsRRFPP......NFlKNPQTTTTQiKKEP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24716 with Med6 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FPPNFLKNPQTTTTQIKKEPETITEEATNEQTDATSRNSELAMNGTQPVVTQPRTQ
207
262










Molecular Recognition Features






MoRF SequenceStartStop




1) KGYWWQFKE
162
170