<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24715
| Description |
Predicted protein |
| Sequence | MSQPSRPLPQSKETLLKSYTKRLKDDVKSILDNFTEILKCSKVEEETQVARLTQSVQDQYEVNVRAANIVRAGESLMKLVSDIKEFLILNDFPSVNESIAERTRRLQAIQNHTDSQLTALKEDMATTLYGLEEALYSSAYR |
| Length | 141 |
| Position | Head |
| Organism | Nematostella vectensis (Starlet sea anemone) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Actiniaria>
Edwardsiidae> Nematostella.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.511 |
| Instability index | 54.81 |
| Isoelectric point | 5.52 |
| Molecular weight | 16085.05 |
| Publications | PubMed=17615350
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24715
No repeats found
No repeats found
|