<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24710
Description |
Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MTSLPNPIPISLRPAPTPAKSSIPLPLLIARINAERGGFRNLSEDSLRQEIAEAELGEDDEENESSSEDGEAEEEPDRMKELLTARDEILGQLDAAMISLDFISLLLSKDAPVQASLSISPSLRELTGTGTLGADKIADSRVTEEQKKENKKIAKGWKASNLSKTVDAILASATRLEKEIDAETKYWEQVLAVSESGWAVCRLPQEKHTLGVRFGFAEASPTFRNRSLGALRRNPDGSIYLDQGITSPEPQSLRVLVETNGVTTGETILPKAVPQDAPIQDLILQARNTIFTSELWQEMIREVRTLASHGLQSDSKTNTITFPLSPTKKILIELQTLPTDPFRPVLGPRPDSYLANGIYLTLHLLLSLSHRRHHRIRTNPPPPISGQPRPNNPFPILRSLLTRFAHETVISSLHSLLTPLCTALTSACLSTPPTYIITPGTSSSFQNLSTPERILTTLTNHLEFLTTITFPFPLSSPPHSSIPSSFSHTTPLTPVPSILQIRTLTITQNYSRPVYYLRITPDTSPLLQICPPPPAVAEWDYVKDYILWAMGCWLAYIFSSPFTKEEEGWKVTTQANILRKIFSGLNDEGGVKQMSFEVSSIPILGPEVPGRVGEKGKEKIRISVRWEWTTGIDQEWKERRDLKQGEGAYDWYSGVGAIGAGELEEVVRKIGDVVEEAGRGKL |
Length | 682 |
Position | Head |
Organism | Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Sclerotiniaceae> Sclerotinia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.308 |
Instability index | 55.04 |
Isoelectric point | 5.61 |
Molecular weight | 75434.93 |
Publications | PubMed=21876677
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP24710
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.66| 20| 72| 245| 264| 1
---------------------------------------------------------------------------
245- 264 (32.51/15.26) ITSPEP.QSLRVLVETNGVTT
273- 292 (25.82/10.76) VPQDAPiQDL.ILQARNTIFT
320- 339 (29.32/13.12) ITFPLS.PTKKILIELQTLPT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 146.45| 34| 37| 433| 469| 2
---------------------------------------------------------------------------
381- 422 (37.03/12.40) PPPISgQPRPN...NPFPILrslltrfahetviSSLHSLLTPLC......T
433- 466 (59.86/26.85) PTYII.TPGTS...SSFQNL.............STPERILTTLTNHLEFLT
471- 503 (49.56/24.45) PFPLS.SPPHSsipSSFSH..............TTP...LTPVPSILQIRT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.12| 26| 96| 1| 28| 4
---------------------------------------------------------------------------
1- 28 (39.99/24.75) MTSLpNPIPISL.RPAPTPAKSSIPlPLL
97- 123 (40.13/17.25) MISL.DFISLLLsKDAPVQASLSIS.PSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 96.90| 24| 118| 221| 244| 6
---------------------------------------------------------------------------
221- 244 (44.91/34.05) PTFRNRSLGALRRNPDGSIYLDQG
341- 357 (33.66/23.27) P.FR.PVLG.....PRPDSYLANG
366- 380 (18.33/ 8.56) LSLSHRRHHRIRTNP.........
---------------------------------------------------------------------------
|