<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24702
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAPVNNADHNIVANQIKNVIQDLYEIMVQTHNYDNAGRPSRETLEKSLLQLSNSLQTVSRTTIPAGPPTGNPQIDRVAGKGTNLAWIPGDVIHYVDNGRNPDIYTREFIELARKNNQLMRGKMQAFGDFRDVLAGEMEKVFPELGEDIKMVMEATIDDTEGK |
Length | 162 |
Position | Middle |
Organism | Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Sclerotiniaceae> Sclerotinia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.548 |
Instability index | 34.10 |
Isoelectric point | 5.05 |
Molecular weight | 18110.23 |
Publications | PubMed=21876677
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP24702
No repeats found
|