<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24699
| Description |
Uncharacterized protein |
| Sequence | MTTKPLVGSQAQRQSQRSLNPNVTSRPSPQRSLSSTSPTRRYNEAFIDLTLDVPDSTSVRYGQTSRTGGSRLKQEISNESRSSSQTETSSSGPSNIISSRQTLPPRGRPQLHFDVPHTRATRSSLTSDQNYSQVFARPFPLPVRPGRHAPPFVEKPSSSIGTSGKKDARPKPFVLEIPPAAPSYSPNGHADFFPWNGNHAEDQFTEIVIRGGFFDKSQMSQNETGSAKASIYPSLKHKSGLQTLSSLFSSVLAQRRAHGNITANSTFKPPPRVTVTDTKREIWLKDLANPTISLRRLSRSIPHGIRGKVLLEHSLNKNIPIERAVWLAKCVGANELRSFKRKGAGGAFAMGGETKWVRDFTVCVEQVLESIIGSCGEKDFRRRIYYAPRALSRLDTIIPRGYFSSQITNMVVDCPGVLGRYFEVSEVRAPVHNYSAESFFRASGF |
| Length | 445 |
| Position | Kinase |
| Organism | Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Sclerotiniaceae> Sclerotinia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.571 |
| Instability index | 60.24 |
| Isoelectric point | 10.32 |
| Molecular weight | 49249.92 |
| Publications | PubMed=21876677
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24699
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 134.33| 35| 37| 103| 139| 1
---------------------------------------------------------------------------
48- 76 (35.33/15.81) ........DLTLDVPDSTSVRYGQ.TSRTGGSR.LKQEI
103- 139 (54.92/37.24) LPPR.GRpQLHFDVPHTRATRSSL.TSDQNYSQvFARPF
141- 173 (44.08/21.83) LPVRpGR...HAP.PFVEKPSSSIgTSGKKDAR..PKPF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.07| 25| 40| 279| 304| 2
---------------------------------------------------------------------------
279- 304 (39.57/28.47) KREIWLKDLANPTiSLRRLSRSIPHG
322- 346 (43.50/26.86) ERAVWLAKCVGAN.ELRSFKRKGAGG
---------------------------------------------------------------------------
|