<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24699

Description Uncharacterized protein
SequenceMTTKPLVGSQAQRQSQRSLNPNVTSRPSPQRSLSSTSPTRRYNEAFIDLTLDVPDSTSVRYGQTSRTGGSRLKQEISNESRSSSQTETSSSGPSNIISSRQTLPPRGRPQLHFDVPHTRATRSSLTSDQNYSQVFARPFPLPVRPGRHAPPFVEKPSSSIGTSGKKDARPKPFVLEIPPAAPSYSPNGHADFFPWNGNHAEDQFTEIVIRGGFFDKSQMSQNETGSAKASIYPSLKHKSGLQTLSSLFSSVLAQRRAHGNITANSTFKPPPRVTVTDTKREIWLKDLANPTISLRRLSRSIPHGIRGKVLLEHSLNKNIPIERAVWLAKCVGANELRSFKRKGAGGAFAMGGETKWVRDFTVCVEQVLESIIGSCGEKDFRRRIYYAPRALSRLDTIIPRGYFSSQITNMVVDCPGVLGRYFEVSEVRAPVHNYSAESFFRASGF
Length445
PositionKinase
OrganismSclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Sclerotiniaceae> Sclerotinia.
Aromaticity0.08
Grand average of hydropathy-0.571
Instability index60.24
Isoelectric point10.32
Molecular weight49249.92
Publications
PubMed=21876677

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex.
ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744
	.uniprot.org/unirule/RU364152' style='color:#FF0000;'>RuleBase:RU364152
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats
>MDP24699
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     134.33|      35|      37|     103|     139|       1
---------------------------------------------------------------------------
   48-   76 (35.33/15.81)	........DLTLDVPDSTSVRYGQ.TSRTGGSR.LKQEI
  103-  139 (54.92/37.24)	LPPR.GRpQLHFDVPHTRATRSSL.TSDQNYSQvFARPF
  141-  173 (44.08/21.83)	LPVRpGR...HAP.PFVEKPSSSIgTSGKKDAR..PKPF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.07|      25|      40|     279|     304|       2
---------------------------------------------------------------------------
  279-  304 (39.57/28.47)	KREIWLKDLANPTiSLRRLSRSIPHG
  322-  346 (43.50/26.86)	ERAVWLAKCVGAN.ELRSFKRKGAGG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP24699 with Med12 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MTTKPLVGSQAQRQSQRSLNPNVTSRPSPQRSLSSTSPTRRYNEAFIDLTLDVPDSTSVRYGQTSRTGGSRLKQEISNESRSSSQTETSSSGPSNIISSRQTLPPRGRPQLHFDVPHTRATRSSLTSDQNYSQVFARPFPLPVRPGRHAPPFVEKPSSSIGTSGKKDARPKPFVLEIPPAA
1
181

Molecular Recognition Features

MoRF SequenceStartStop
1) RYNEAFIDLTL
41
51