| Description | Uncharacterized protein |
| Sequence | MYQQLFEIYQHLISFLSQQRVMADRLTQLQDAIDELALQFVASLVWVNKHHDYQTLSPTDIVRKDTKKDESGEALPNEDGLEPLPADKFKEGQVELARDLIVKEQQIEVLITALPGLENSEKEQQQTIQRLERELKEEEERRKEALKEKEAVLARLEGVIRSIKRP |
| Length | 166 |
| Position | Middle |
| Organism | Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Sclerotiniaceae> Sclerotinia. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.678 |
| Instability index | 49.90 |
| Isoelectric point | 4.98 |
| Molecular weight | 19331.73 |
| Publications | PubMed=21876677 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP24694
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.70| 11| 23| 122| 132| 4
---------------------------------------------------------------------------
122- 132 (18.77/11.32) KEQQQTIQRLE
147- 157 (16.92/ 9.60) KEKEAVLARLE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KKDESGEALPNEDGLEPLPADKFKE 2) TIQRLEREL 3) VELAR | 67 127 94 | 91 135 98 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab