<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24676
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MREAEDISNNVTTDPRKDGESYVGKGIGLDLMDIDTSDHRRTDHDRQNRGLDQSFGGNTMDLDYKATSSTQEEELSLAALQQDIGTAFHLCKSSYTVSGPNPSLDLVSLYGLGPVASSVARTDPVTGEKINRLRKSYEGKIKGLGLAGRNKPVKAEPGTPGGLKYLTLWPEEEWQNQKVYGKDIKVAEPDSSFFKQQLKAMKMEPGSLPNHEFWEML |
| Length | 217 |
| Position | Head |
| Organism | Ajellomyces capsulatus (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.758 |
| Instability index | 31.71 |
| Isoelectric point | 5.33 |
| Molecular weight | 24023.57 |
| Publications | PubMed=19717792
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24676
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.86| 14| 114| 13| 29| 1
---------------------------------------------------------------------------
13- 29 (24.51/19.96) TDP.........RKdgeSYVGK..GIGL
122- 146 (17.35/ 6.74) TDPvtgekinrlRK...SYEGKikGLGL
---------------------------------------------------------------------------
|