| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MTSEVKPQNYIQDRLDALSEIDSRIVSLLESFSTVFESYSKKDKEGFASETKSIYQQLSKVAINLRKEVKHMDDNIGVYDKNKDGVMILPINVDQKNTLLGREKLNLEVVEMAQLLGKDSPFDSGLAPAPLDEQKKDTSTQENSSSVNIKEEFKDNDNSNDNDNEKEQEKDGSSADDRDQSMVDVANAADVAEVSDAAEVNRVNEVPGSTPGSTPGSSRDQIMADVEVVEPQKEDTSRQPDGESSDKDEDFEMVE |
| Length | 255 |
| Position | Head |
| Organism | Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Lodderomyces. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.920 |
| Instability index | 41.25 |
| Isoelectric point | 4.29 |
| Molecular weight | 28248.38 |
| Publications | PubMed=19465905 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP24668
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 126.69| 33| 38| 147| 184| 1
---------------------------------------------------------------------------
148- 184 (45.19/23.35) .NIKEEFKDNDNSNdndneKEQEKDGSS.....AD.DRDQSMVD
189- 225 (41.13/14.11) ADV.AEVSDAAEVN.....RVNEVPGSTpgstpGS.SRDQIMAD
226- 255 (40.38/13.75) VEVVEPQKEDTS.........RQPDGES.....SDkDEDFEMVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 114.14| 34| 37| 65| 98| 2
---------------------------------------------------------------------------
65- 98 (58.03/35.53) LRKEVKHMDDNIGVYDKNKDGVMILPINVDQKNT
105- 138 (56.10/34.14) LNLEVVEMAQLLGKDSPFDSGLAPAPLDEQKKDT
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KDEDFEMVE 2) RDQIMADVEVVEPQKEDTSRQP | 247 219 | 255 240 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab