Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MTSEVKPQNYIQDRLDALSEIDSRIVSLLESFSTVFESYSKKDKEGFASETKSIYQQLSKVAINLRKEVKHMDDNIGVYDKNKDGVMILPINVDQKNTLLGREKLNLEVVEMAQLLGKDSPFDSGLAPAPLDEQKKDTSTQENSSSVNIKEEFKDNDNSNDNDNEKEQEKDGSSADDRDQSMVDVANAADVAEVSDAAEVNRVNEVPGSTPGSTPGSSRDQIMADVEVVEPQKEDTSRQPDGESSDKDEDFEMVE |
Length | 255 |
Position | Head |
Organism | Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Lodderomyces. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.920 |
Instability index | 41.25 |
Isoelectric point | 4.29 |
Molecular weight | 28248.38 |
Publications | PubMed=19465905 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP24668 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 126.69| 33| 38| 147| 184| 1 --------------------------------------------------------------------------- 148- 184 (45.19/23.35) .NIKEEFKDNDNSNdndneKEQEKDGSS.....AD.DRDQSMVD 189- 225 (41.13/14.11) ADV.AEVSDAAEVN.....RVNEVPGSTpgstpGS.SRDQIMAD 226- 255 (40.38/13.75) VEVVEPQKEDTS.........RQPDGES.....SDkDEDFEMVE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 114.14| 34| 37| 65| 98| 2 --------------------------------------------------------------------------- 65- 98 (58.03/35.53) LRKEVKHMDDNIGVYDKNKDGVMILPINVDQKNT 105- 138 (56.10/34.14) LNLEVVEMAQLLGKDSPFDSGLAPAPLDEQKKDT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KDEDFEMVE 2) RDQIMADVEVVEPQKEDTSRQP | 247 219 | 255 240 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab