<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24668

Description Mediator of RNA polymerase II transcription subunit 11
SequenceMTSEVKPQNYIQDRLDALSEIDSRIVSLLESFSTVFESYSKKDKEGFASETKSIYQQLSKVAINLRKEVKHMDDNIGVYDKNKDGVMILPINVDQKNTLLGREKLNLEVVEMAQLLGKDSPFDSGLAPAPLDEQKKDTSTQENSSSVNIKEEFKDNDNSNDNDNEKEQEKDGSSADDRDQSMVDVANAADVAEVSDAAEVNRVNEVPGSTPGSTPGSSRDQIMADVEVVEPQKEDTSRQPDGESSDKDEDFEMVE
Length255
PositionHead
OrganismLodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Lodderomyces.
Aromaticity0.04
Grand average of hydropathy-0.920
Instability index41.25
Isoelectric point4.29
Molecular weight28248.38
Publications
PubMed=19465905

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP24668
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     126.69|      33|      38|     147|     184|       1
---------------------------------------------------------------------------
  148-  184 (45.19/23.35)	.NIKEEFKDNDNSNdndneKEQEKDGSS.....AD.DRDQSMVD
  189-  225 (41.13/14.11)	ADV.AEVSDAAEVN.....RVNEVPGSTpgstpGS.SRDQIMAD
  226-  255 (40.38/13.75)	VEVVEPQKEDTS.........RQPDGES.....SDkDEDFEMVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     114.14|      34|      37|      65|      98|       2
---------------------------------------------------------------------------
   65-   98 (58.03/35.53)	LRKEVKHMDDNIGVYDKNKDGVMILPINVDQKNT
  105-  138 (56.10/34.14)	LNLEVVEMAQLLGKDSPFDSGLAPAPLDEQKKDT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24668 with Med11 domain of Kingdom Fungi
Unable to open file!