<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24659

Description Uncharacterized protein
SequenceMSADYWNSSQRSRWQFTRYSLLEARRKLLFLERRMIQNGLIRDYPNIVYDYNMRIYLHNLLLKLGRRMNVRQIAIATAEVYLSRFLTRVSLKEINVYLLVTTCLYVACKIEECPQHIRLILSEARNIWSEYIPHDVTKLAEFEFYLIEEMDSYMVLHHPYKLLIQLRDFLETKYEVYGFKLSEEEMQNSWSLINDSYITDLHLLVPPHIIAVAAIYITVVLKKNLAQLRNKTSPSGISSLMSTMVTSTKNNTLDNSGAGSYSTKGVSQNSITPEMLNSLTDGVESGTGSGLGLGESEGGGLSNEGTGVAGVGDSGVNVKNLQIDKGNKTTPSPTILSDHHLLADSLQAAGHKQEPRLQLPKAKGMSNLDFVNFEVDILDEDTINIHKFMNFLEHSHINLDEVVEAVQDMVGTYVLWNRYNEQGVKKALQIMLLRR
Length435
PositionKinase
OrganismLodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Lodderomyces.
Aromaticity0.08
Grand average of hydropathy-0.211
Instability index52.66
Isoelectric point6.25
Molecular weight49432.04
Publications
PubMed=19465905

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblFungi
GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding	GO:0000979	IEA:EnsemblFungi
GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
positive regulation of transcription by galactose	GO:0000411	IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle	GO:0010673	IEA:EnsemblFungi

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP24659
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     119.41|      36|      38|     230|     265|       1
---------------------------------------------------------------------------
  230-  265 (62.20/41.04)	NKTSPSGISSLMSTMVTSTKNN.TLDNSGAGSYSTKG
  269-  305 (57.21/37.18)	NSITPEMLNSLTDGVESGTGSGlGLGESEGGGLSNEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.84|      24|      34|     137|     160|       3
---------------------------------------------------------------------------
  137-  160 (44.57/33.72)	TKLAEFEFYLIEE..MDSYMVLHHPY
  172-  197 (38.27/27.88)	TKYEVYGFKLSEEemQNSWSLINDSY
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP24659 with CycC domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
NANANA

Molecular Recognition Features

MoRF SequenceStartStop
NANANA