<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24659

Description Uncharacterized protein
SequenceMSADYWNSSQRSRWQFTRYSLLEARRKLLFLERRMIQNGLIRDYPNIVYDYNMRIYLHNLLLKLGRRMNVRQIAIATAEVYLSRFLTRVSLKEINVYLLVTTCLYVACKIEECPQHIRLILSEARNIWSEYIPHDVTKLAEFEFYLIEEMDSYMVLHHPYKLLIQLRDFLETKYEVYGFKLSEEEMQNSWSLINDSYITDLHLLVPPHIIAVAAIYITVVLKKNLAQLRNKTSPSGISSLMSTMVTSTKNNTLDNSGAGSYSTKGVSQNSITPEMLNSLTDGVESGTGSGLGLGESEGGGLSNEGTGVAGVGDSGVNVKNLQIDKGNKTTPSPTILSDHHLLADSLQAAGHKQEPRLQLPKAKGMSNLDFVNFEVDILDEDTINIHKFMNFLEHSHINLDEVVEAVQDMVGTYVLWNRYNEQGVKKALQIMLLRR
Length435
PositionKinase
OrganismLodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Lodderomyces.
Aromaticity0.08
Grand average of hydropathy-0.211
Instability index52.66
Isoelectric point6.25
Molecular weight49432.04
Publications
PubMed=19465905

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblFungi

GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding	GO:0000979	IEA:EnsemblFungi

GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
positive regulation of transcription by galactose	GO:0000411	IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle	GO:0010673	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP24659
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     119.41|      36|      38|     230|     265|       1
---------------------------------------------------------------------------
  230-  265 (62.20/41.04)	NKTSPSGISSLMSTMVTSTKNN.TLDNSGAGSYSTKG
  269-  305 (57.21/37.18)	NSITPEMLNSLTDGVESGTGSGlGLGESEGGGLSNEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.84|      24|      34|     137|     160|       3
---------------------------------------------------------------------------
  137-  160 (44.57/33.72)	TKLAEFEFYLIEE..MDSYMVLHHPY
  172-  197 (38.27/27.88)	TKYEVYGFKLSEEemQNSWSLINDSY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24659 with CycC domain of Kingdom Fungi
Unable to open file!