<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24656
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLPYRRPDSPLLSSLISRTASATKLNQLYQDSATRSATATPSAYVTSSLNPARNVPILDSSSRFQNGNPSIDSLPVISHIDEFRALLDELSEAVTLFKDDEVFTKFEKLTKLNTTIENDIKELHLHKQRRKSLKQLQNRHKSLDDLQKNTLKKLLSYRSELRKLPRAKTYELKQDKDNDPNSLKIDVKDIFAYSMKLAKFSKAPVAMGNLSHQIHPNNYIWPAEDSLRRGMLAMSYIQEKEILENVLGEEKPVSVAKEETSKENSERVSILPSKESGDTSLNGTPHPSNRDHIEIAPTAPTAPTAVDEDENGYSNEVADLDLDLFDPDAELSD |
| Length | 333 |
| Position | Middle |
| Organism | Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade>
Lodderomyces.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.704 |
| Instability index | 49.84 |
| Isoelectric point | 5.61 |
| Molecular weight | 37459.56 |
| Publications | PubMed=19465905
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24656
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.22| 29| 33| 135| 167| 1
---------------------------------------------------------------------------
135- 167 (41.88/34.32) QLQNRHksldDLQKNTL....KKLLSYRSELRKLPRA
171- 203 (41.34/24.51) ELKQDK....DNDPNSLkidvKDIFAYSMKLAKFSKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.15| 12| 27| 31| 42| 2
---------------------------------------------------------------------------
31- 42 (20.50/14.02) DSATRSATATPS
59- 70 (22.65/16.27) DSSSRFQNGNPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.78| 18| 33| 235| 252| 3
---------------------------------------------------------------------------
235- 252 (30.06/19.86) SYIQEKEILENVL.GEEKP
269- 287 (27.72/17.79) SILPSKESGDTSLnGTPHP
---------------------------------------------------------------------------
|