Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSENEDLISSLYPPPPPYFKFFTEENRAKLEAWQKDHDGKEQSVPEPPGELKFLVPPKQPEGTHYRGYGSLWSFEDKLPSLEDSGWKKLYESVDDQDTSRAKIHELHKLTDSLLLCFLELIGIMSIEPQQFHVKIEDLKLILININHILNTYRPHQSRESLIMLLRQNIEQKRSEITEIDKTCDSIRQRIEAIMDQDTGQSEVVEPSSEKPNRQAIVSEILTNFRENSQ |
Length | 229 |
Position | Middle |
Organism | Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Meyerozyma. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.730 |
Instability index | 77.05 |
Isoelectric point | 5.03 |
Molecular weight | 26645.73 |
Publications | PubMed=19465905 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP24636 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.77| 22| 98| 83| 105| 1 --------------------------------------------------------------------------- 83- 105 (34.99/26.71) DSGWKKLyESVDDQDTSRAKIHE 184- 205 (37.78/23.46) DSIRQRI.EAIMDQDTGQSEVVE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.41| 10| 31| 13| 22| 2 --------------------------------------------------------------------------- 13- 22 (23.91/11.56) PPPPPYFKFF 45- 54 (20.50/ 9.09) PEPPGELKFL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MSENEDLISSLYP 2) PPPYFKFFTEENRAKLEAWQKDHDGK | 1 15 | 13 40 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab