<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24635
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MFLTLTFPLTKFINLLLRTFMVHQLSLVSTVEHGYYVQTVATLKALTGLQSTQNIATYNLVTKPHDVFKPKVEAGKVNQIEQYYMKCITTWDEDTGDIEKPILKDSNTVEASRLFVGDNNKRIWTLQISDIPVAGKNQTCSAQTIYDSTLVHHHTKVVDKVEKENSDQFEFVRNDSFLQFLSDLGYDVINQFWLKGVRFFHGDIVIEIFKVFIRDDERQSSDNAIALKLLDESNTFQFKAYINVPKATDVDAINQGTKELLKLQDFLKNLVKLEIPDRIHMDSRVSK |
Length | 287 |
Position | Head |
Organism | Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Meyerozyma.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.239 |
Instability index | 26.80 |
Isoelectric point | 6.07 |
Molecular weight | 33016.34 |
Publications | PubMed=19465905
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24635
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.38| 20| 46| 28| 48| 1
---------------------------------------------------------------------------
28- 48 (29.29/28.43) VSTVEHgYYVQTVATLKALTG
77- 96 (39.08/31.56) VNQIEQ.YYMKCITTWDEDTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 133.28| 42| 65| 164| 208| 2
---------------------------------------------------------------------------
164- 208 (69.49/52.86) ENSDQFEFvrnDSFLQFLSDLGYDVINQ...FWLKGVRFFHGDIVIEI
231- 275 (63.79/40.87) DESNTFQF...KAYINVPKATDVDAINQgtkELLKLQDFLKNLVKLEI
---------------------------------------------------------------------------
|