| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MSEFDYSKVPVESLESLRNRLNQVHLSLRKLADQVNHNIRNPNKAKLPNYAQFQNQFHVLITQLQSIASILTNDDDILKRTNAYPLPNFPTTEQEALVTTLLRKKPLPEVEGWMKDAIGRGALQESDLEKDEAFVKWCAETVQDLRDEFQFYGFHSQQELEFLETEEGKKEAQRKRDLELEQEEEKMRTTGGKQPLHPNKVLKFMYQGVLDDS |
| Length | 213 |
| Position | Head |
| Organism | Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Meyerozyma. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.810 |
| Instability index | 56.57 |
| Isoelectric point | 5.26 |
| Molecular weight | 24805.64 |
| Publications | PubMed=19465905 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP24631
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.46| 13| 23| 102| 124| 1
---------------------------------------------------------------------------
85- 97 (23.66/13.35) PLPNFPTTEQEAL
106- 118 (24.80/17.80) PLPEVEGWMKDAI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.26| 14| 23| 157| 170| 2
---------------------------------------------------------------------------
157- 170 (23.56/14.29) QQELEFLETEEGKK
181- 194 (24.70/15.28) EQEEEKMRTTGGKQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KQPLHPNKVLKFMYQGVLDDS 2) QRKRDLELEQEEEKMRTT | 193 173 | 213 190 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab