<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24628
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLPRKKNDGFLSVPISRVSSTQRLNQLNTVSRPNSPSYISSSLNPSRNVPITPTNHDAKNDIPNFENVPIVATLTEFENQLDAFTASISSFKGDQLADSMSQLVQLNDTLKQELESLKTHQELGKRIGQLKQQNLELDTKAKQMLRELISCRAELRKMPRLSSKGDDKESQNKEIDVKEALKYAMKLAKFTRAPPMVGNAQFQIHPNNFIWPAEDSLRRGMLALSSLKPEELIKQELGTAENSEAEQTMAEEHNEPEEDIIQSFDNNESKGNAAPLSLDLFDSEEDSD |
| Length | 288 |
| Position | Middle |
| Organism | Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Meyerozyma.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.749 |
| Instability index | 53.39 |
| Isoelectric point | 5.04 |
| Molecular weight | 32338.84 |
| Publications | PubMed=19465905
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24628
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.66| 20| 24| 208| 231| 1
---------------------------------------------------------------------------
212- 231 (33.46/25.80) PAEDSLRRGMLALSSLKPEE
239- 258 (34.20/15.01) TAENSEAEQTMAEEHNEPEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.02| 24| 24| 82| 105| 2
---------------------------------------------------------------------------
82- 105 (39.75/31.01) DAFTASISSFKGDQ.LADSMSQLVQ
108- 132 (35.28/26.69) DTLKQELESLKTHQeLGKRIGQLKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.58| 10| 16| 45| 54| 3
---------------------------------------------------------------------------
45- 54 (20.43/13.00) PS.RNVPITPT
63- 73 (14.15/ 6.93) PNfENVPIVAT
---------------------------------------------------------------------------
|