Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDGGAATNASGVAAAAAAAGNGVQAGGGGERAEDASKQNLALMMASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNSLVAELDTMQKHAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQEKEKKNHQFVVTMRDGHCQTYNTAATKPSTNASKQERERKIASGESKREKDPLILCIDQPHPKSSIQLSYGEEAITNLLNDTYKKDTTR |
Length | 216 |
Position | Middle |
Organism | Oryza sativa subsp. indica (Rice) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.571 |
Instability index | 22.45 |
Isoelectric point | 6.22 |
Molecular weight | 23279.84 |
Publications | PubMed=15685292 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP24603 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.59| 13| 16| 46| 58| 1 --------------------------------------------------------------------------- 46- 58 (22.61/16.16) SIQRTLGLLHQLN 65- 77 (21.98/15.53) SSASQLPLLQRLN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.17| 18| 20| 4| 21| 2 --------------------------------------------------------------------------- 4- 21 (27.69/16.26) GAATNASGVAAAAAAAGN 22- 39 (30.48/18.54) GVQAGGGGERAEDASKQN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KDPLILCI 2) RERKIA | 177 164 | 184 169 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab