<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24601
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEEAEARPAPPDPNDARQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPTPAPAPAAVPPSASVPSTVVPPVAAPPSALLPMSAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKKDG |
| Length | 203 |
| Position | Middle |
| Organism | Oryza sativa subsp. indica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.527 |
| Instability index | 57.56 |
| Isoelectric point | 9.44 |
| Molecular weight | 22925.11 |
| Publications | PubMed=15685292
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24601
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.78| 19| 19| 122| 140| 1
---------------------------------------------------------------------------
122- 140 (38.68/14.31) PPPEPTPTPAPAPAAVPPS
144- 162 (35.10/12.43) PSTVVPPVAAPPSALLPMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.80| 24| 27| 16| 39| 2
---------------------------------------------------------------------------
16- 39 (44.32/28.79) ARQRFLLELEFIQCL......ANPTYIHYL
40- 69 (38.48/24.20) AQNRYFEDEAFIGYLkylkywQRPEYIKYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.20| 11| 19| 176| 186| 3
---------------------------------------------------------------------------
176- 186 (21.05/12.80) GTPGTNIPKND
192- 202 (20.14/12.00) GGQGGRKRKKD
---------------------------------------------------------------------------
|