Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEEAEARPAPPDPNDARQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPTPAPAPAAVPPSASVPSTVVPPVAAPPSALLPMSAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKKDG |
Length | 203 |
Position | Middle |
Organism | Oryza sativa subsp. indica (Rice) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.527 |
Instability index | 57.56 |
Isoelectric point | 9.44 |
Molecular weight | 22925.11 |
Publications | PubMed=15685292 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP24601 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 73.78| 19| 19| 122| 140| 1 --------------------------------------------------------------------------- 122- 140 (38.68/14.31) PPPEPTPTPAPAPAAVPPS 144- 162 (35.10/12.43) PSTVVPPVAAPPSALLPMS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 82.80| 24| 27| 16| 39| 2 --------------------------------------------------------------------------- 16- 39 (44.32/28.79) ARQRFLLELEFIQCL......ANPTYIHYL 40- 69 (38.48/24.20) AQNRYFEDEAFIGYLkylkywQRPEYIKYI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.20| 11| 19| 176| 186| 3 --------------------------------------------------------------------------- 176- 186 (21.05/12.80) GTPGTNIPKND 192- 202 (20.14/12.00) GGQGGRKRKKD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWKNYRNNRLK 2) GGRKRKKD | 106 195 | 116 202 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab