<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24587
Description |
Uncharacterized protein |
Sequence | MEGGGAGSGMERWREMFRGADIYDVIRNAILIAGADSPRELLRRRQGIIEWLFAVAPVTVPVPAPLACGRVVDGAGNRLPPAAIPDGGGHHHDDNDGNFAAAEAQTSLIDQQILEALYDEIEEDTQVINEVLRIKDILINYKEQSVDTLFDGLRRLQLMRLSISVLKSTQIAEAVAPLNKHRSPVICKIARDLAK |
Length | 195 |
Position | Unknown |
Organism | Oryza sativa subsp. indica (Rice) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.131 |
Instability index | 59.41 |
Isoelectric point | 5.26 |
Molecular weight | 21370.19 |
Publications | PubMed=15685292
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24587
No repeats found
|