<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24586
| Description |
"Aspergillus niger contig An18c0110, genomic contig" |
| Sequence | MAPIPLSTVDITNSIFCPADLKDVIQHLFEIQSAVHGYLGPETQQELVRKMYPPSYPCHLPHLRFHSTNGLRVMHSERTSPSRSPPSAHTPPIITPTHNHNHQETATTLPSTASNSPPRLSTT |
| Length | 123 |
| Position | Middle |
| Organism | Aspergillus niger (strain CBS 513.88 / FGSC A1513) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.510 |
| Instability index | 69.64 |
| Isoelectric point | 7.16 |
| Molecular weight | 13618.22 |
| Publications | PubMed=17259976
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24586
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.87| 13| 23| 85| 97| 2
---------------------------------------------------------------------------
85- 97 (26.29/10.39) PPSA.HTPPIITPT
110- 123 (19.58/ 6.24) PSTAsNSPPRLSTT
---------------------------------------------------------------------------
|