<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24563

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMDFPGGSITNIRVIDGFSNIYWRIYTEEPNIATLSGDSPTNGFTILRHLSRLKDLELRLRNLDCLVSSYPRRLGLWVFSATPDFESLGPLCSNGTNDDPSKLFVDSATLKVSASGSVTSKELVKNLSAEPVNAATNSQGVQRRQNGPNPPRRTDGHGSSAAIYASFISAVTGALSLQLIRCNNAIPLGSRTLFTVVAEDYYDNPRIDNDNPAAVPSLTTLQIQLTSVGKLTVSLQTISQPGIIRLCGPYDTSVGVHNAHPGCDLWLSPSGSIARLVATHSDSQNASSGHTMANPPNTSNLEEWKALVIEWLGNYGLPLISSEEEPWVEVEVWEPFYSRLAGEIWRQNEEGASVLPLKRILWPARYCFTRKKPTSLDPFLGINDSFPVIDEPLGFAEKWLGMGQLNHEETDSKPASRPEPETKDQETPLSRPDLPEGIESLSRAAEYPDLQASNLVYPTPPDGAFPVGPNAPPASDAAAEDLDSRHLTNRALAKVKTKEGASARERSDHDVLMSFGPSPGLIVGSGLYDTNDDDDLFGEINQRDFGSKGITDADFSFFDDPEFNHLSGDVNEMDVGAQETPEITVDAEEPKPHPLPLEQPLTDNLPGQRDTTEQIDTIPAHPQEKISNPQPADVPLSASMQISSPVNEDNQTISPPLSPIEVKKTLFAGPNEDSKLSVKKGHLQGHYNPVAFKKNILDWDQKYGAEGKFRVTGAVVNHHTVPTSTTGDIPTIGLPRRNARTKNPHGPARNNDKPRSPASDLDQPIPSDSDFDSTSDTSDDSDGNLSNSDESVATFVTRKRKRARSYSGSSVNLPQQKPLARSEQSIATSRTDDLVFLGNFLSTFSDWSMTGYFSATQKQLAPVLIRKDAQIQVAQLLVDQVTQSCLDHKVDGILSVSEFESKAYCLRTFLEDTAFMGEIERLDLNGFVSLQENSGLSSPSTATMSRQSSQRKENGKSSMSKLAPPHLRIRRGKDYLEVLPPAISFWETFGLEPAYGSKDIYAYCIHPQIAAEAANDFLERLGLLYSSCNLGQHTRASRSTGFDRGMCSWNIGAPGEFNYHYIMQSLKSICDKLVTALLKSPPMKDTVVVYIINPFSHAAALADICSAFWGLFQKYIDEVEKQQAGQAKELVLQIVPFHFIMSTESLVVPPQAQYLSLALEVYSRCPPKSLQSCLLNCAPPMLIAEPVPKTINFKLAPDSSSPLQEAKSLHIACSRSYDQRWVSVSWTDNTGTLQRTISYCLRFQNSNAARNILEVRNEIWAATKIIMEKTQARWKIIIVNTEPVDQDEVDTWTSLVEQYNMTKPFLSDLTILYVNTTPDLYLEPPPQPLPMSVFNPQISSTPVATPNPSGNAFSPEQPGNAPTPPSGGNAPTPTEIPPDAESECLLTDICDESWGIILSHCLNSSPHLTDYRPALASGYLLRRKGPTDADGAFAMNVNLIYSQKPASLYENLLREIIARYRDLATLARARGTRTVQQNTFPWHIATAVRAQELLSYIL
Length1497
PositionKinase
OrganismNeosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Fumigati.
Aromaticity0.08
Grand average of hydropathy-0.397
Instability index51.92
Isoelectric point5.13
Molecular weight164573.73
Publications
PubMed=18404212

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP24563
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.30|      17|      17|    1344|    1360|       1
---------------------------------------------------------------------------
 1344- 1360 (35.01/18.44)	TPNPSGNAFSP.EQPGNA
 1362- 1379 (31.29/15.53)	TPPSGGNAPTPtEIPPDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.29|      10|      17|    1148|    1157|       2
---------------------------------------------------------------------------
 1148- 1157 (19.11/ 8.89)	PP...QAQYLSLA
 1165- 1177 (16.18/ 6.42)	PPkslQSCLLNCA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.29|      16|      17|     746|     761|       3
---------------------------------------------------------------------------
  746-  761 (28.41/13.81)	PARNN.DKPRSPASDLD
  765-  781 (22.88/ 9.62)	PSDSDfDSTSDTSDDSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.22|      23|     139|    1178|    1201|       4
---------------------------------------------------------------------------
 1178- 1201 (37.66/20.64)	PPMLIaEPVPKTINFK.LAPD.SSSP
 1317- 1341 (38.55/17.38)	PDLYL.EPPPQPLPMSvFNPQiSSTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.42|      17|      17|     544|     560|       5
---------------------------------------------------------------------------
  544-  560 (30.42/16.50)	FG..SKGITDADFSFFDDP
  562-  580 (22.99/10.78)	FNhlSGDVNEMDVGAQETP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.49|      13|      16|     790|     804|       7
---------------------------------------------------------------------------
  790-  804 (15.91/15.42)	SVAtfVTRKRKRARS
  809-  821 (22.58/13.40)	SVN..LPQQKPLARS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     198.81|      58|     303|      22|      99|       9
---------------------------------------------------------------------------
   29-   86 (100.66/95.44)	PNIATLSGDSPTNGFTILRHLSRLKDLELRLRNLDCLVSSYPRRLGLW.VFSATPDFES
  938-  996 (98.15/51.22)	PSTATMSRQSSQRKENGKSSMSKLAPPHLRIRRGKDYLEVLPPAISFWeTFGLEPAYGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     168.22|      53|     216|     371|     434|      13
---------------------------------------------------------------------------
  371-  434 (85.98/61.17)	KPTSL.......DPFLGINDSFPVIDE.PLGFAEKWlgmgqlnheeTDSKPASRP........EPETKDQETpLSRPDLP
  590-  658 (82.24/39.43)	KPHPLpleqpltDNLPGQRDTTEQIDTiPAHPQEKI..........SNPQPADVPlsasmqisSPVNEDNQT.ISPPLSP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24563 with Med13 domain of Kingdom Fungi
Unable to open file!