<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24560
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSTQTSQQPTLGPTNSFPTPASSVSGHFMGPTSVEDSEHAGTSFEHVQADSGATTATGLHASSTQQSEHRRTDHDRELEGPTPGIDVRDFAGMDVPHTRDDTDAMDVDKDVNASAKSDGLSLESLQQDFSSAFHLCKSSLIATGPDPALDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHDPSAPGGLRHLTMWPEEEWQNQKVYGKEIKVADVDSALHNLQMKAMQMEPGTVPNNEYWEDVLGHEKPSKHAGHWDGKKAATLPNTARSPSQANESPLPTEPERARPSRGRKRHYDDNSFVGYGEGYADDDDDAAFYSNSEGMGKKKRKKVRSHAIWDGSWTRLIVLVFLKEHVSKVSTPLPDRGGSYGVGMFGIGAR |
Length | 398 |
Position | Head |
Organism | Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Fumigati.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.782 |
Instability index | 36.36 |
Isoelectric point | 6.10 |
Molecular weight | 43309.46 |
Publications | PubMed=18404212
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24560
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 166.29| 54| 62| 2| 63| 2
---------------------------------------------------------------------------
2- 61 (85.51/48.89) STQTSQQPTLGPTNSF..PTPASSVSgHFMG...PTSVEDSEHAgtsfeHVQADSGATTAT.GLHA
63- 122 (80.78/38.83) STQQSEHRRTDHDRELegPTPGIDVR.DFAGmdvPHTRDDTDAM.....DVDKDVNASAKSdGLSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.54| 15| 81| 263| 277| 3
---------------------------------------------------------------------------
263- 277 (31.02/16.88) LGHEKPSKHAGH..WDG
343- 359 (24.51/12.01) MGKKKRKKVRSHaiWDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.26| 11| 15| 316| 326| 4
---------------------------------------------------------------------------
316- 326 (21.67/15.08) DDNSFVGYGEG
332- 342 (20.59/13.97) DDAAFYSNSEG
---------------------------------------------------------------------------
|