<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24556
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAVQQDASMEEILWRSPPHVQMMGGFLHSNNKSPFFDATSNNASLVIQANYNEAFRHFVETREAFENRLRTMQGLEFVVAYDPLQAAAQSDTKFAHEPSNIWVIHKQMRRKRAGQEDEIVVLSTFFVVGDCIYMAPSVASVVGNRILSAVTSLTSLLKTASTLPTFTPSHGHTYLPPAPKPADGGQPGLASQQSKENTPMPDAENSARVPLVGSQTGNTASTFQDTRTLAESFNLFVRYENEYMDESPLVGEPGSFIMSKSTETGAAKQPPIPVPMRTETPVVRVDTPGKVPEKVGTPLSSDESRLKKKKGRAGS |
| Length | 315 |
| Position | Head |
| Organism | Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Fumigati.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.425 |
| Instability index | 53.26 |
| Isoelectric point | 6.40 |
| Molecular weight | 34443.46 |
| Publications | PubMed=18404212
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24556
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.29| 14| 15| 262| 275| 1
---------------------------------------------------------------------------
262- 275 (26.60/13.30) TETGAAK.QPPIPVP
278- 292 (21.69/ 9.73) TETPVVRvDTPGKVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.62| 16| 17| 89| 104| 2
---------------------------------------------------------------------------
89- 104 (29.19/21.73) QSDTKFAHEPSNIWVI
107- 122 (26.43/19.04) QMRRKRAGQEDEIVVL
---------------------------------------------------------------------------
|