<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24555
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDCASSASFRVGPPSPSSPASGSLKEDHPPYISSENIPQTPTSPPLMSVSAQNYATNITSSQPPSQATSQPANLSSPPSSAPMSTQTSQQPTVGMATSFPTPASSVSGHFMGPTSGEDSEQAEKAFGHARADTGTNSGTDMSAASTQQSEHRRTDHDRDLATSTSDIGIRDFANMDHQIARSDTDAMDIDKDTGASSNPNGLSLESLQQDFSSAFHLCKSSYVATGPDPTLDLISLYGLGPVAKSVARLDPNTGEKINRLRKSYEGKLKGLGLAGRNKPVKHEPNMPGGLRHLTMWPEEEWYNQKVYGKDIKVADMESALQNLQMKAMQMEPGTVPNNDYWEDVLGHEKPSKHVGHSDGKKASVPPNGPRAVSQSNGTPVPTELDRARPSRGRKRHYDDSSFVGYGEGYADDDDDGAFYSNSEGIGKKKRKKDHVSKVSTPLPDRGGSYGVGMFGIGAR |
| Length | 460 |
| Position | Head |
| Organism | Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Fumigati.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.831 |
| Instability index | 48.23 |
| Isoelectric point | 5.97 |
| Molecular weight | 49143.42 |
| Publications | PubMed=18404212
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24555
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 146.12| 30| 30| 60| 89| 1
---------------------------------------------------------------------------
14- 42 (28.07/ 8.01) ....PP.S..PSSPASGSlkedHPPYiSSENIPQTP
60- 87 (46.95/18.20) TSSQPP.SQATSQPANLS....SPPS.SAPMSTQ..
88- 116 (42.96/16.05) TSQQPTvGMATSFPTPAS....SV...SGHFMGPTS
118- 143 (28.14/ 8.04) EDSEQA.EKAFGHARADT....GTNS.GTDMS....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.37| 25| 30| 237| 266| 2
---------------------------------------------------------------------------
237- 261 (42.28/26.39) LYGLGPVAKS.VARLDPNTGEKINRL
269- 294 (41.10/16.02) LKGLGLAGRNkPVKHEPNMPGGLRHL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.14| 10| 17| 158| 167| 4
---------------------------------------------------------------------------
158- 167 (16.76/ 9.96) DRDLATSTSD
177- 186 (17.38/10.62) DHQIARSDTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.61| 11| 15| 399| 409| 5
---------------------------------------------------------------------------
399- 409 (21.38/11.86) DDSSFVGYGEG
415- 425 (21.23/11.73) DDGAFYSNSEG
---------------------------------------------------------------------------
|