<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24551
| Description |
Uncharacterized protein |
| Sequence | MVFPRGGGGSGGGFRGRGGGDRGRGRGFGGRGGDRGGTPFKARGGGRGGGRGGRGGGRGGRGGGMKGGNKVVVEPHRHEGIFIAKGKEDALVTKNLVPGEAVYNEKRITVQKEDGSKDEYRIWNPFRSKLAAAILGGVDNIWIKPGARVLYLGAASGTTVSHVSDIVGPTGVVYAVEFSHRSGRDLVNMAKKRTNIIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILGLNASYYLKSGGHFVISIKANCIDSTVPAETVFASEVNKLKADQFKPFEQVTLEPFERDHACVVGGYRVPKKKKDAE |
| Length | 309 |
| Position | Unknown |
| Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
genistoids sensu lato> core genistoids> Genisteae> Lupinus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.420 |
| Instability index | 29.60 |
| Isoelectric point | 10.02 |
| Molecular weight | 32845.00 |
| Publications | PubMed=27557478
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | methyltransferase activity GO:0008168 IEA:UniProtKB-KW
RNA binding GO:0003723 IEA:UniProtKB-KW
|
| GO - Biological Process | methylation GO:0032259 IEA:UniProtKB-KW
rRNA processing GO:0006364 IEA:UniProtKB-KW
|
Interaction
Repeat regions
| Repeats |
>MDP24551
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.62| 19| 24| 11| 33| 1
---------------------------------------------------------------------------
6- 26 (36.76/ 9.29) GG.GGsGGG..FRGRGGGdRGRGR
29- 51 (29.85/10.52) GGrGGdRGGtpFKARGGG.RGGGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.32| 17| 17| 190| 206| 2
---------------------------------------------------------------------------
190- 206 (30.07/22.36) AKKR..TNIIPII.EDARHP
207- 226 (20.25/12.97) AKYRmlVGMVDVIfSDVAQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.80| 13| 16| 61| 73| 3
---------------------------------------------------------------------------
61- 73 (23.47/11.40) RGGGM...KGGNKVVV
77- 92 (17.33/ 6.53) RHEGIfiaKGKEDALV
---------------------------------------------------------------------------
|