<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24541
Description |
Uncharacterized protein |
Sequence | MSTSAFPPPPPYYRLYKNYSQDPNSAPEPPPPIEGTYVCFGATYTCIYVLFTIIAESWGYCGPCSRSCGRCDYNCDSNVVEIVITSDNLPSLEEQGVRQLYPKGANVDFKKELKSLNRDLQLHTLELADILIERPSQYARRIEEISTVFKNLHHLLNALRPHQARSTLVRILELQILNRKRAVEDIKR |
Length | 188 |
Position | Middle |
Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
genistoids sensu lato> core genistoids> Genisteae> Lupinus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.389 |
Instability index | 65.31 |
Isoelectric point | 7.57 |
Molecular weight | 21504.35 |
Publications | PubMed=27557478
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24541
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.60| 13| 18| 4| 16| 1
---------------------------------------------------------------------------
4- 16 (29.53/14.51) SAFPPPPPYYRLY
25- 37 (28.07/13.50) SAPEPPPPIEGTY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.79| 34| 60| 81| 118| 2
---------------------------------------------------------------------------
81- 118 (51.73/42.53) EIVITSDNLPSLeeqgVRQLYPKGANVDFKK..ELKSLNR
144- 179 (53.06/33.90) EISTVFKNLHHL....LNALRPHQARSTLVRilELQILNR
---------------------------------------------------------------------------
|