<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24527

Description Uncharacterized protein
SequenceMLQHQVVQSPARLGLTNPNSPSIPNPTPPKLPPSQTHHNQPHQDRHSTTPSSALLSLLPPLPRAQALLQQMASLASKLFEVSSNRSLWITAFRGSLPTFLSSQGQAHFSTQLETSPSSTKEILSLFTVFQTQIFEAVAELQEILDLQDAKQKIDHEIRSKDSALLAFANKLKDAERGLDILVDDYSDYRRTKRTKSDGSEDDSLISSTISSQLKLADILSYAHRISYTTFAPPEFGAGLAPLRGALPPAPQDEQMRASQLYHFADLDIGLPKVETKEKTIEAIIVPPPPQPVDKNPLADLSSIQGLLPPNFMVPPGWKPGMPVQLPMDIPIKPPPGWKPGDPVPLPPVDSLPVPRFEELPHPQIPQPKQPEVIQVQHVNLDLGGTDSSDYSSDDASTDDED
Length401
PositionMiddle
OrganismLupinus angustifolius (Narrow-leaved blue lupine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> genistoids sensu lato> core genistoids> Genisteae> Lupinus.
Aromaticity0.05
Grand average of hydropathy-0.451
Instability index61.81
Isoelectric point5.15
Molecular weight43948.16
Publications
PubMed=27557478

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP24527
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.08|      15|      18|     313|     330|       1
---------------------------------------------------------------------------
  313-  330 (29.19/17.57)	V..PPGWKPGMPVQLPmdiP
  331-  347 (28.89/10.77)	IkpPPGWKPGDPVPLP...P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.66|       9|      73|     286|     296|       2
---------------------------------------------------------------------------
  286-  296 (17.18/11.70)	PPPPQPvdKNP
  362-  370 (20.48/ 7.85)	PQIPQP..KQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.58|      20|     200|     178|     202|       3
---------------------------------------------------------------------------
  178-  202 (30.97/31.97)	LDILVDDYSDYrrtkrTKSDGSEDD
  380-  399 (36.61/24.13)	LDLGGTDSSDY.....SSDDASTDD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.74|      27|     221|      10|      38|       4
---------------------------------------------------------------------------
   10-   38 (45.14/24.81)	PARL..GLTnPNSPSIPnPTP..PKLPPSQTHH
  232-  262 (42.61/16.47)	PPEFgaGLA.PLRGALP.PAPqdEQMRASQLYH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.29|      19|      65|      40|      58|       5
---------------------------------------------------------------------------
   40-   58 (35.01/17.51)	QPH.QDRHSTTPSSA..LLSLL
  105-  126 (24.28/10.23)	QAHfSTQLETSPSSTkeILSLF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24527 with Med4 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PVQLPMDIPIKPPPGWKPGDPVPLPPVDSLPVPRFEELPHPQIPQPKQPEVIQVQHVNLDLGGTDSSDYSSDDASTDDED
2) QVVQSPARLGLTNPNSPSIPNPTPPKLPPSQTHHNQPHQDRHSTTPSSALL
322
5
401
55










Molecular Recognition Features






MoRF SequenceStartStop




NANANA