Description | Uncharacterized protein |
Sequence | MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKVEGFMASQNESGSSTKTTPSLPKNIYKDPDDGRQRLLLELEFIQCLANPTYIHYLAQNRYFEDEGFIEYLKYLQYWQRPEYIKFIMYPHSLYFLELLQNANFRNAMAHPNNKELAHRQQFYFWKNYRNNRLKHLLPRSLPETSATPAPPAPTSTSNQMPLPALPPAPTTNVTVTASSTRAPSPMPYGIPPGSTIPKNEMRNSAVEKRKRK |
Length | 251 |
Position | Middle |
Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> genistoids sensu lato> core genistoids> Genisteae> Lupinus. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.659 |
Instability index | 50.30 |
Isoelectric point | 9.66 |
Molecular weight | 28761.54 |
Publications | PubMed=27557478 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP24514 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.16| 16| 22| 194| 209| 1 --------------------------------------------------------------------------- 194- 209 (32.95/16.92) STSNQMPLP.ALPPAPT 218- 234 (28.20/13.50) STRAPSPMPyGIPPGST --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 35.82| 10| 21| 83| 95| 2 --------------------------------------------------------------------------- 83- 95 (16.15/19.66) FIQCLanpTYIHY 107- 116 (19.67/12.11) FIEYL...KYLQY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 78.88| 17| 17| 136| 152| 3 --------------------------------------------------------------------------- 118- 131 (19.09/ 9.91) ...QRPEYIKFIMYPHS 136- 152 (28.51/18.23) ELLQNANFRNAMAHPNN 154- 170 (31.28/20.67) ELAHRQQFYFWKNYRNN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWKNYR 2) IPKNEMRNSAVEKRK | 163 235 | 168 249 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab