<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24514
| Description |
Uncharacterized protein |
| Sequence | MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKVEGFMASQNESGSSTKTTPSLPKNIYKDPDDGRQRLLLELEFIQCLANPTYIHYLAQNRYFEDEGFIEYLKYLQYWQRPEYIKFIMYPHSLYFLELLQNANFRNAMAHPNNKELAHRQQFYFWKNYRNNRLKHLLPRSLPETSATPAPPAPTSTSNQMPLPALPPAPTTNVTVTASSTRAPSPMPYGIPPGSTIPKNEMRNSAVEKRKRK |
| Length | 251 |
| Position | Middle |
| Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
genistoids sensu lato> core genistoids> Genisteae> Lupinus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.659 |
| Instability index | 50.30 |
| Isoelectric point | 9.66 |
| Molecular weight | 28761.54 |
| Publications | PubMed=27557478
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24514
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.16| 16| 22| 194| 209| 1
---------------------------------------------------------------------------
194- 209 (32.95/16.92) STSNQMPLP.ALPPAPT
218- 234 (28.20/13.50) STRAPSPMPyGIPPGST
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.82| 10| 21| 83| 95| 2
---------------------------------------------------------------------------
83- 95 (16.15/19.66) FIQCLanpTYIHY
107- 116 (19.67/12.11) FIEYL...KYLQY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.88| 17| 17| 136| 152| 3
---------------------------------------------------------------------------
118- 131 (19.09/ 9.91) ...QRPEYIKFIMYPHS
136- 152 (28.51/18.23) ELLQNANFRNAMAHPNN
154- 170 (31.28/20.67) ELAHRQQFYFWKNYRNN
---------------------------------------------------------------------------
|