<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24510
Description |
Uncharacterized protein |
Sequence | MASQNESGSSTKTTPSLPRNIYNDPDDGRQRLLLELEFIQCLANPIYIHCFIGYLKYLQYWQRPEYIKFIMYPHSLYFLELLHNANFRNAMAHPNNKVLSIRIGTGHRQQFYFWKNYRNNRLKHLLLRLIPETSATPAPPAPTSTSNQMPLPTLPPAPTINVTVTASSTPAPSLMTYGIPPGSTIPKNEMRNSAVEKRKRK |
Length | 201 |
Position | Middle |
Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
genistoids sensu lato> core genistoids> Genisteae> Lupinus.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.513 |
Instability index | 45.24 |
Isoelectric point | 9.89 |
Molecular weight | 23028.27 |
Publications | PubMed=27557478
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24510
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.60| 16| 17| 139| 154| 1
---------------------------------------------------------------------------
139- 154 (32.90/16.31) PPAPT....STSNQMPLPTL
155- 174 (25.69/11.40) PPAPTinvtVTASSTPAPSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.30| 15| 16| 39| 54| 2
---------------------------------------------------------------------------
39- 54 (26.35/18.51) IQCLANPIYIHcFIGY
58- 72 (31.96/17.12) LQYWQRPEYIK.FIMY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.79| 20| 23| 83| 102| 3
---------------------------------------------------------------------------
83- 102 (35.67/24.13) HNANFRNAMAHPNNKV..LSIR
107- 128 (33.12/21.91) HRQQFYFWKNYRNNRLkhLLLR
---------------------------------------------------------------------------
|