<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24506

Description Uncharacterized protein
SequenceMAHSWARGSLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFADKEVQKDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILIKMKETAEAFLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDHRIMDYFIKLIKKKHGKDISKDNRALGKLRRESERAKRALSSQHQVRVEIESLFDGVDFSEPLTRARFEELNNDLFRKTMGPVKKAMEDAGLQKSQIDEIVLVGGSTRIPKVQQLLKDYFEGKEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKAEDKGTGKAEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNALETYIYNLKNQIGDKDKLADKLESDEKEKIETAVKEALEWLDDNQSAEKEEYDEKLKEVEAVCNPIITAVYQRSGGAPGADASAEDDDDSHDEL
Length666
PositionUnknown
OrganismLupinus angustifolius (Narrow-leaved blue lupine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> genistoids sensu lato> core genistoids> Genisteae> Lupinus.
Aromaticity0.06
Grand average of hydropathy-0.414
Instability index27.14
Isoelectric point5.12
Molecular weight73301.25
Publications
PubMed=27557478

Function

Annotated function 
GO - Cellular Component
endoplasmic reticulum	GO:0005783	IEA:UniProtKB-KW

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP24506
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.77|      26|      27|     573|     599|       1
---------------------------------------------------------------------------
  573-  599 (38.33/30.49)	LETYIYNLKNQIgDKDKLADKLESDEK
  602-  627 (43.44/29.22)	IETAVKEALEWL.DDNQSAEKEEYDEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.02|      11|      27|     231|     241|       2
---------------------------------------------------------------------------
  231-  241 (20.52/11.64)	LGGGTFDVSIL
  259-  269 (22.49/13.44)	LGGEDFDHRIM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.18|      18|      21|      37|      55|       3
---------------------------------------------------------------------------
   37-   55 (29.36/21.72)	VIGIDLGT..TYSCVGvYKNG
   59-   78 (28.82/16.67)	IIANDQGNriTPSWVG.FTDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.64|      23|     244|     388|     423|       4
---------------------------------------------------------------------------
  205-  227 (40.99/16.82)	INEPTA....AAIAYG.LDKKGGE..KNIL
  394-  423 (26.65/25.88)	VNPDEAvaygAAVQGGiLSGEGGDetKDIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     157.96|      49|     104|     342|     390|       5
---------------------------------------------------------------------------
  342-  390 (82.54/58.42)	RKTMGPVKKAMEDAGLQKSQID.EIVLVGGSTRIPKVQQLLKDY.FEGKEP
  447-  497 (75.43/52.74)	RNTVIPTKKSQVFTTYQDQQTTvSIQVFEGERSLTKDCRLLGKFdLTGIPP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24506 with Med37 domain of Kingdom Viridiplantae
Unable to open file!