<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24506

Description Uncharacterized protein
SequenceMAHSWARGSLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFADKEVQKDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILIKMKETAEAFLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDHRIMDYFIKLIKKKHGKDISKDNRALGKLRRESERAKRALSSQHQVRVEIESLFDGVDFSEPLTRARFEELNNDLFRKTMGPVKKAMEDAGLQKSQIDEIVLVGGSTRIPKVQQLLKDYFEGKEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKAEDKGTGKAEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNALETYIYNLKNQIGDKDKLADKLESDEKEKIETAVKEALEWLDDNQSAEKEEYDEKLKEVEAVCNPIITAVYQRSGGAPGADASAEDDDDSHDEL
Length666
PositionUnknown
OrganismLupinus angustifolius (Narrow-leaved blue lupine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> genistoids sensu lato> core genistoids> Genisteae> Lupinus.
Aromaticity0.06
Grand average of hydropathy-0.414
Instability index27.14
Isoelectric point5.12
Molecular weight73301.25
Publications
PubMed=27557478

Function

Annotated function
GO - Cellular Component
endoplasmic reticulum	GO:0005783	IEA:UniProtKB-KW
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP24506
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.77|      26|      27|     573|     599|       1
---------------------------------------------------------------------------
  573-  599 (38.33/30.49)	LETYIYNLKNQIgDKDKLADKLESDEK
  602-  627 (43.44/29.22)	IETAVKEALEWL.DDNQSAEKEEYDEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.02|      11|      27|     231|     241|       2
---------------------------------------------------------------------------
  231-  241 (20.52/11.64)	LGGGTFDVSIL
  259-  269 (22.49/13.44)	LGGEDFDHRIM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.18|      18|      21|      37|      55|       3
---------------------------------------------------------------------------
   37-   55 (29.36/21.72)	VIGIDLGT..TYSCVGvYKNG
   59-   78 (28.82/16.67)	IIANDQGNriTPSWVG.FTDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.64|      23|     244|     388|     423|       4
---------------------------------------------------------------------------
  205-  227 (40.99/16.82)	INEPTA....AAIAYG.LDKKGGE..KNIL
  394-  423 (26.65/25.88)	VNPDEAvaygAAVQGGiLSGEGGDetKDIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     157.96|      49|     104|     342|     390|       5
---------------------------------------------------------------------------
  342-  390 (82.54/58.42)	RKTMGPVKKAMEDAGLQKSQID.EIVLVGGSTRIPKVQQLLKDY.FEGKEP
  447-  497 (75.43/52.74)	RNTVIPTKKSQVFTTYQDQQTTvSIQVFEGERSLTKDCRLLGKFdLTGIPP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP24506 with Med37 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
NANANA

Molecular Recognition Features

MoRF SequenceStartStop
NANANA