<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24494
Description |
Uncharacterized protein |
Sequence | MAHGVLSPRVNLEASQAIATIQALCSSMKRVFDCLKVGVWNKEMLEGCEKGFVAAFQESLRSLSHNLGEQSGFSESDGSCNHCSVALPAALDVRCGGQVFRDLVKKLHKAVPGSVPALQEVPAGWPAARVEGFPNTWSFS |
Length | 140 |
Position | Tail |
Organism | Anas platyrhynchos platyrhynchos (Northern mallard) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae>
Anatinae> Anas.
|
Aromaticity | 0.07 |
Grand average of hydropathy | 0.009 |
Instability index | 54.07 |
Isoelectric point | 6.88 |
Molecular weight | 14988.00 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24494
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.25| 15| 15| 51| 65| 1
---------------------------------------------------------------------------
51- 65 (26.17/16.55) GFVAAFQESLRSLSH
68- 82 (29.07/19.07) GEQSGFSESDGSCNH
---------------------------------------------------------------------------
|