<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24494
| Description |
Uncharacterized protein |
| Sequence | MAHGVLSPRVNLEASQAIATIQALCSSMKRVFDCLKVGVWNKEMLEGCEKGFVAAFQESLRSLSHNLGEQSGFSESDGSCNHCSVALPAALDVRCGGQVFRDLVKKLHKAVPGSVPALQEVPAGWPAARVEGFPNTWSFS |
| Length | 140 |
| Position | Tail |
| Organism | Anas platyrhynchos platyrhynchos (Northern mallard) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae>
Anatinae> Anas.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.009 |
| Instability index | 54.07 |
| Isoelectric point | 6.88 |
| Molecular weight | 14988.00 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24494
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.25| 15| 15| 51| 65| 1
---------------------------------------------------------------------------
51- 65 (26.17/16.55) GFVAAFQESLRSLSH
68- 82 (29.07/19.07) GEQSGFSESDGSCNH
---------------------------------------------------------------------------
|