<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24492
| Description |
Uncharacterized protein |
| Sequence | MGWAEPLQPPWLAASLVGLILAKWGRLWGARSPVSATWPRSFLAEALLEQAMIGPSPNPLILSYLKYAISSQVIALPVPQTLLAVTSRPQLAGREPGGGGHTPQTSRLHPTGITPAWYGEEGGSVGAPGGEISVNIAASCTRGGDHCPESLHTASVQHFNVA |
| Length | 162 |
| Position | Tail |
| Organism | Anas platyrhynchos platyrhynchos (Northern mallard) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae>
Anatinae> Anas.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.041 |
| Instability index | 59.02 |
| Isoelectric point | 6.96 |
| Molecular weight | 16946.16 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24492
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.12| 22| 23| 79| 100| 1
---------------------------------------------------------------------------
79- 100 (40.75/21.26) PQT..LLAVTSRPQLAGREPGGGG
103- 126 (39.36/20.31) PQTsrLHPTGITPAWYGEEGGSVG
---------------------------------------------------------------------------
|