<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24488
| Description |
mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MDLAYICEWEKWPKSTHCPSVPLACTWSCRNLIAFTTDLRSDDQDLTRMIHILDTEHPWDVHSVCSEHSEAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSWESPVGSLVEGDPIVALSWLHNGVKLALHVEKGQHPCGQQRPCDWRGEIPEFLPVPHGSAQRPLERGAAWVQGAELRPRCHTSPVVLLTIKWGYRWPW |
| Length | 203 |
| Position | Tail |
| Organism | Physeter macrocephalus (Sperm whale) (Physeter catodon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti>
Physeteridae> Physeter.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.356 |
| Instability index | 43.69 |
| Isoelectric point | 5.59 |
| Molecular weight | 23019.85 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24488
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 107.23| 23| 23| 153| 175| 2
---------------------------------------------------------------------------
133- 150 (28.50/11.78) .....LHVEKGQHPCGQ..QRPCDW
153- 175 (42.01/20.30) EIPEFLPVPHGSAQRPL..ERGAAW
177- 201 (36.72/16.96) QGAELRPRCHTSPVVLLtiKWGYRW
---------------------------------------------------------------------------
|