<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24487

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMVSPVLRVFSRVVLTTVLGRTDEDTEGQRGPCHTALEWLRQDLNSSSRSRGFCHVVPPCSQGCDSQKGVLGSQRQTPEGQARAGGRGCPELTPPPPPQSGASSFGEKFSRVKFSPSLTLFGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAFTGGGNIVVATADGSSASPVQFYKVCVSVVNEKCRIDTEILPSLFMRCTTDLNRRDRLPAITHLKFLARDMSEQVLLCASSQTSSVVECWSLRKEGLPVNNIFQQLSPAVGDKQPTILKWRILSATNDLDRVSAVALPKLPISLTNTDLKVASDTQFYPGLGLALAFHDGSVHIVHRLSLQTMAIFYSSAAPRSVDEPAIKRPRATGPAVHFKAMQLSWTSLALVGIDNHGRLSMLRISPSMGHSLDAGLALRHLLFLLEYCMVTGYDWWDILLHVQPSMVQSLVEKLHEEYTRQKAELQQVLSTRILAMKASLCKLSPCAVTRVCEYHAKLFLIAASSTLKSLLRPHVLNTPDKSPGDRLTEICAKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLASLPNQGSPLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPTSEPDEALVDECCLLPSQLLIPSLDWLPVSDGLVSRLQPKQPLRLHFGKPPALPGSATSLQLDGLIRAPGQPKMDHLRRLHLGAYPTEACKACTRCGCVTMLKSPNKTTAVKQWEQRWIKNCLCGGLWWRMPLSYP
Length790
PositionTail
OrganismPhyseter macrocephalus (Sperm whale) (Physeter catodon)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti> Physeteridae> Physeter.
Aromaticity0.06
Grand average of hydropathy-0.011
Instability index53.69
Isoelectric point8.88
Molecular weight86924.20
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP24487
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.91|      24|      34|     681|     712|       1
---------------------------------------------------------------------------
  681-  705 (42.50/38.71)	LPVsDGLV.SRLQPKQP..LRLHFGKPP
  714-  740 (37.42/15.45)	LQL.DGLIrAPGQPKMDhlRRLHLGAYP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.05|      27|      35|      40|      73|       2
---------------------------------------------------------------------------
   40-   67 (48.28/21.47)	RQDLNSSSRS..RGfCHVV..PPCSQGCDSQK
   74-  104 (41.77/24.21)	RQTPEGQARAggRG.CPELtpPPPPQSGASSF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.57|      19|      37|     394|     414|       3
---------------------------------------------------------------------------
  394-  414 (31.47/25.24)	GIDNHGRLsmLRISPSMGHSL
  434-  452 (39.10/24.39)	GYDWWDIL..LHVQPSMVQSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     102.28|      30|      35|     587|     619|       4
---------------------------------------------------------------------------
  587-  619 (50.86/36.87)	PLRPGHSFLRDGTSL..GMLRELMVVIRIWGllkP
  623-  654 (51.42/30.10)	PVYTATSDTQDSMSLlfRLLTKLWICCRDEG...P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     109.08|      36|      55|     196|     235|       5
---------------------------------------------------------------------------
  196-  235 (54.30/43.93)	SVVneKC.RIDTEILP..SLFMRCTTDLNrrDRLPAITHLKFL
  253-  291 (54.79/32.16)	SVV..ECwSLRKEGLPvnNIFQQLSPAVG..DKQPTILKWRIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     101.57|      30|      36|     116|     145|       6
---------------------------------------------------------------------------
  116-  145 (51.41/32.81)	SLTLFGGKPMEGWIAVTVSGLVTVSLLKPS
  154-  183 (50.16/31.84)	SLCRLRGRVALADIAFTGGGNIVVATADGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.53|      12|      36|     486|     500|       7
---------------------------------------------------------------------------
  486-  500 (18.16/19.64)	SPC.AVTRVCeyhAKL
  524-  536 (18.37/ 9.17)	SPGdRLTEIC...AKI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.13|      14|      36|     340|     353|       8
---------------------------------------------------------------------------
  340-  353 (24.16/17.22)	VHI.VHRLSLQTMAI
  378-  392 (20.97/13.89)	VHFkAMQLSWTSLAL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24487 with Med16 domain of Kingdom Metazoa
Unable to open file!