<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24480
Description |
Uncharacterized protein |
Sequence | PWLYAMLVVHNMALSISGPRELTGAVDLISQYKLEPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPPSIKPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKDKDKDKDRKKDKHHEKVAAFSLCL |
Length | 184 |
Position | Head |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.062 |
Instability index | 32.30 |
Isoelectric point | 9.32 |
Molecular weight | 21239.11 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24480
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.14| 16| 19| 135| 153| 1
---------------------------------------------------------------------------
138- 153 (31.33/16.03) KHKDKDKDREHKKHKH
158- 173 (28.82/ 7.83) RSKDKDKDKDRKKDKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.88| 16| 18| 72| 87| 2
---------------------------------------------------------------------------
72- 87 (28.10/26.02) ELDQLVQNAYLRDKPP
93- 108 (27.78/25.64) DMETLGQAFQLRETAP
---------------------------------------------------------------------------
|